Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 9.5e-05

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 9.5e-05

AA Sequence

MGLSGLLPILVPFILLGDIQEPGHAEGILGKPCPKIKVECEVEEIDQCTKPRDCPENMKCCPFSRGKKCL      1 - 70
DFRKIYAVCHRRLAPAWPPYHTGGTIKKTKICSEFIYGGSQGNNNNFQTEAICLVTCKKYH              71 - 131
//

Text Mined References (6)

PMID Year Title