Property Summary

NCBI Gene PubMed Count 5
Grant Count 1
Funding $288,636.6
PubMed Score 0.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

AA Sequence

MGLSGLLPILVPFILLGDIQEPGHAEGILGKPCPKIKVECEVEEIDQCTKPRDCPENMKCCPFSRGKKCL      1 - 70
DFRKIYAVCHRRLAPAWPPYHTGGTIKKTKICSEFIYGGSQGNNNNFQTEAICLVTCKKYH              71 - 131
//

Text Mined References (6)

PMID Year Title
23292442 2013 Reproduction and immunity-driven natural selection in the human WFDC locus.
15950183 2005 The evolution of a genetic locus encoding small serine proteinase inhibitors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12206714 2002 A locus on human chromosome 20 contains several genes expressing protease inhibitor domains with homology to whey acidic protein.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.