Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.50
PubTator Score 9.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Oligospermia 36 3.565 1.8
Breast fibroadenoma 8 3.049 1.5

Gene RIF (3)

AA Sequence

MEPPDQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKLKSAGAQGGEE      1 - 70
KDGGGEEKDGGGAGVPGHLWEGDLEGTSGSDGNVEDSDQSEKEPGQQYSRPQGAVGGLEPGNAQQPNVHA     71 - 140
FTPLQLQELERIFQREQFPSEFLRRRLARSMNVTELAVQIWFENRRAKWRRHQRALMARNMLPFMAVGQP    141 - 210
VMVTAAEAITAPLFISGMRDDYFWDHSHSSSLCFPMPPFPPPSLPLPLMLLPPMPPAGQAEFGPFPFVIV    211 - 280
PSFTFPNV                                                                  281 - 288
//

Text Mined References (20)

PMID Year Title