Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.50
PubTator Score 9.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (3)

PMID Text
23682428 PEPP2 has a role in regulating function of membrane and microtubules
21988730 In striking contrast to non-human primates, humans appear to have homogenized their two RHOXF2 copies by the endogenous retrovirus -mediated non-allelic recombination mechanism.
21874235 RHOXF2 is highly expressed in some leukemia cell lines and a variety of human cancers. Results indicate that RHOXF2 is involved in carcinogenesis.

AA Sequence

MEPPDQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKLKSAGAQGGEE      1 - 70
KDGGGEEKDGGGAGVPGHLWEGDLEGTSGSDGNVEDSDQSEKEPGQQYSRPQGAVGGLEPGNAQQPNVHA     71 - 140
FTPLQLQELERIFQREQFPSEFLRRRLARSMNVTELAVQIWFENRRAKWRRHQRALMARNMLPFMAVGQP    141 - 210
VMVTAAEAITAPLFISGMRDDYFWDHSHSSSLCFPMPPFPPPSLPLPLMLLPPMPPAGQAEFGPFPFVIV    211 - 280
PSFTFPNV                                                                  281 - 288
//

Text Mined References (16)

PMID Year Title
26464818 2015 Upregulation of RHOXF2 and ODF4 Expression in Breast Cancer Tissues.
25780578 2014 RHOXF2 gene, a new candidate gene for spermatogenesis failure.
25416956 2014 A proteome-scale map of the human interactome network.
25292049 2014 Are so-called cancer-testis genes expressed only in testis?
23682428 2012 A likely role for a novel PH-domain containing protein, PEPP2, in connecting membrane and cytoskeleton.
23482336 2013 The RHOX homeobox gene cluster is selectively expressed in human oocytes and male germ cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988730 2011 Rapid evolution and copy number variation of primate RHOXF2, an X-linked homeobox gene involved in male reproduction and possibly brain function.
21874235 2012 Identification of RHOXF2 (PEPP2) as a cancer-promoting gene by expression cloning.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
More...