Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.83
PubTator Score 3.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.800 2.1e-05
astrocytic glioma -1.100 2.0e-03
Astrocytoma, Pilocytic -1.300 9.8e-07
atypical teratoid / rhabdoid tumor -1.700 2.6e-06
ependymoma -1.500 8.3e-15
glioblastoma -1.400 2.1e-08
lung carcinoma 1.400 2.6e-25
medulloblastoma -1.200 3.0e-06
medulloblastoma, large-cell -1.700 8.2e-06
oligodendroglioma -1.200 9.0e-22
primitive neuroectodermal tumor -1.400 2.6e-04

 GO Function (1)

Gene RIF (4)

AA Sequence

MTLLLLPLLLASLLASCSCNKANKHKPWIEAEYQGIVMENDNTVLLNPPLFALDKDAPLRYAGEICGFRL      1 - 70
HGSGVPFEAVILDKATGEGLIRAKEPVDCEAQKEHTFTIQAYDCGEGPDGANTKKSHKATVHVRVNDVNE     71 - 140
FAPVFVERLYRAAVTEGKLYDRILRVEAIDGDCSPQYSQICYYEILTPNTPFLIDNDGNIENTEKLQYSG    141 - 210
ERLYKFTVTAYDCGKKRAADDAEVEIQVKPTCKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDEPLWNI    211 - 280
QATIELQTSHVAKGCDRDNYSERALRKLCGAATGEVDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQ    281 - 350
AVQVPLGGPSGLGSGPQDSLSDHFTLSFWMKHGVTPNKGKKEEETIVCNTVQNEDGFSHYSLTVHGCRIA    351 - 420
FLYWPLLESARPVKFLWKLEQVCDDEWHHYALNLEFPTVTLYTDGISFDPALIHDNGLIHPPRREPALMI    421 - 490
GACWTEEKNKEKEKGDNSTDTTQGDPLSIHHYFHGYLAGFSVRSGRLESREVIECLYACREGLDYRDFES    491 - 560
LGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTLRFATPGVRPLRLTTAVKCFSEESCVSIPEVE    561 - 630
GYVVVLQPDAPQILLSGTAHFARPAVDFEGTNGVPLFPDLQITCSISHQVEAKKDESWQGTVTDTRMSDE    631 - 700
IVHNLDGCEISLVGDDLDPERESLLLDTTSLQQRGLELTNTSAYLTIAGVESITVYEEILRQARYRLRHG    701 - 770
AALYTRKFRLSCSEMNGRYSSNEFIVEVNVLHSMNRVAHPSHVLSSQQFLHRGHQPPPEMAGHSLASSHR    771 - 840
NSMIPSAATLIIVVCVGFLVLMVVLGLVRIHSLHRRVSGAGGPPGASSDPKDPDLFWDDSALTIIVNPME    841 - 910
SYQNRQSCVTGAVGGQQEDEDSSDSEVADSPSSDERRIIETPPHRY                            911 - 956
//

Text Mined References (13)

PMID Year Title