Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.97
PubTator Score 3.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.100 0.002
glioblastoma -1.700 0.000
oligodendroglioma -1.200 0.000
ependymoma -1.500 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.700 0.000
primitive neuroectodermal tumor -1.400 0.000
adult high grade glioma -1.800 0.000
pilocytic astrocytoma -1.300 0.000
lung carcinoma 1.400 0.000

Synonym

Accession Q9BQT9 D3DUT6 O94831 Q2T9J5 Q5UE57
Symbols CSTN3
CDHR14
alcbeta

Gene

PANTHER Protein Class (1)

 GO Function (1)

Gene RIF (4)

PMID Text
26213366 ApoE expression attenuated intracellular trafficking of APP and Alcbeta
25352602 structure of Calsyntenin 3 and its interaction with neurexin 1alpha
23499467 The C-terminal fragment but not full-length Cst-3 accumulated in dystrophic neurites surrounding amyloidbeta plaques in Tg2576 mouse and Alzheimer disease brains.
15037614 Alcadein and amyloid beta-protein precursor regulates FE65-dependent gene transactivation [alcalpha1, alcbeta, alcgamma]

AA Sequence

MTLLLLPLLLASLLASCSCNKANKHKPWIEAEYQGIVMENDNTVLLNPPLFALDKDAPLRYAGEICGFRL      1 - 70
HGSGVPFEAVILDKATGEGLIRAKEPVDCEAQKEHTFTIQAYDCGEGPDGANTKKSHKATVHVRVNDVNE     71 - 140
FAPVFVERLYRAAVTEGKLYDRILRVEAIDGDCSPQYSQICYYEILTPNTPFLIDNDGNIENTEKLQYSG    141 - 210
ERLYKFTVTAYDCGKKRAADDAEVEIQVKPTCKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDEPLWNI    211 - 280
QATIELQTSHVAKGCDRDNYSERALRKLCGAATGEVDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQ    281 - 350
AVQVPLGGPSGLGSGPQDSLSDHFTLSFWMKHGVTPNKGKKEEETIVCNTVQNEDGFSHYSLTVHGCRIA    351 - 420
FLYWPLLESARPVKFLWKLEQVCDDEWHHYALNLEFPTVTLYTDGISFDPALIHDNGLIHPPRREPALMI    421 - 490
GACWTEEKNKEKEKGDNSTDTTQGDPLSIHHYFHGYLAGFSVRSGRLESREVIECLYACREGLDYRDFES    491 - 560
LGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTLRFATPGVRPLRLTTAVKCFSEESCVSIPEVE    561 - 630
GYVVVLQPDAPQILLSGTAHFARPAVDFEGTNGVPLFPDLQITCSISHQVEAKKDESWQGTVTDTRMSDE    631 - 700
IVHNLDGCEISLVGDDLDPERESLLLDTTSLQQRGLELTNTSAYLTIAGVESITVYEEILRQARYRLRHG    701 - 770
AALYTRKFRLSCSEMNGRYSSNEFIVEVNVLHSMNRVAHPSHVLSSQQFLHRGHQPPPEMAGHSLASSHR    771 - 840
NSMIPSAATLIIVVCVGFLVLMVVLGLVRIHSLHRRVSGAGGPPGASSDPKDPDLFWDDSALTIIVNPME    841 - 910
SYQNRQSCVTGAVGGQQEDEDSSDSEVADSPSSDERRIIETPPHRY                            911 - 956
//

Text Mined References (13)

PMID Year Title
26213366 2015 Stabilization of intracellular trafficking and metabolism of amyloid ?-protein precursor and Alcadein ? by apolipoprotein E.
25352602 2014 Calsyntenin-3 molecular architecture and interaction with neurexin 1?.
23499467 2013 Calsyntenin-3 C-terminal fragment accumulates in dystrophic neurites surrounding a? plaques in tg2576 mouse and Alzheimer disease brains: its neurotoxic role in mediating dystrophic neurite formation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15037614 2004 Coordinated metabolism of Alcadein and amyloid beta-protein precursor regulates FE65-dependent gene transactivation.
12972431 2003 Novel cadherin-related membrane proteins, Alcadeins, enhance the X11-like protein-mediated stabilization of amyloid beta-protein precursor metabolism.
More...