Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.68
PubTator Score 3.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 1.95875101086538E-4
sonic hedgehog group medulloblastoma 1482 3.76452951391861E-4

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.228 0.000
sonic hedgehog group medulloblastoma 1.100 0.000

Synonym

Accession Q9BQT8 A8K0L0 G3V4L5 Q3MJ99
Symbols ODC
ODC1

Gene

  Ortholog (16)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (7)

PMID Text
23333304 HIV-1 Vif downregulates the expression of solute carrier family 25, member 21 (SLC25A21) in Vif-expression T cells
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSAKPEVSLVREASRQIVAGGSAGLVEICLMHPLDVVKTRFQIQRCATDPNSYKSLVDSFRMIFQMEGLF      1 - 70
GFYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSGLTEAIVVNPFEVVKVGLQAN     71 - 140
RNTFAEQPSTVGYARQIIKKEGWGLQGLNKGLTATLGRHGVFNMVYFGFYYNVKNMIPVNKDPILEFWRK    141 - 210
FGIGLLSGTIASVINIPFDVAKSRIQGPQPVPGEIKYRTCFKTMATVYQEEGILALYKGLLPKIMRLGPG    211 - 280
GAVMLLVYEYTYSWLQENW                                                       281 - 299
//

Text Mined References (13)

PMID Year Title
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...