Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.68
PubTator Score 3.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.0e-04
sonic hedgehog group medulloblastoma 467 3.8e-04

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.228 2.0e-04
sonic hedgehog group medulloblastoma 1.100 3.8e-04

Protein-protein Interaction (3)

Gene RIF (7)

AA Sequence

MSAKPEVSLVREASRQIVAGGSAGLVEICLMHPLDVVKTRFQIQRCATDPNSYKSLVDSFRMIFQMEGLF      1 - 70
GFYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSGLTEAIVVNPFEVVKVGLQAN     71 - 140
RNTFAEQPSTVGYARQIIKKEGWGLQGLNKGLTATLGRHGVFNMVYFGFYYNVKNMIPVNKDPILEFWRK    141 - 210
FGIGLLSGTIASVINIPFDVAKSRIQGPQPVPGEIKYRTCFKTMATVYQEEGILALYKGLLPKIMRLGPG    211 - 280
GAVMLLVYEYTYSWLQENW                                                       281 - 299
//

Text Mined References (13)

PMID Year Title