Property Summary

NCBI Gene PubMed Count 28
Grant Count 82
R01 Count 62
Funding $6,405,598.98
PubMed Score 89.85
PubTator Score 50.48

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BQS7 B1AJX8 D3DVT7 E9PHN8 O75180 Q6UW45 Q9C058
Symbols CPL

Gene

Gene RIF (14)

PMID Text
24988611 This review describes function of hephaestin as ferroxidase is essential for iron binding to apotransferrin in the lamina propria of the intestinal mucosa, a process that is important for further transport of iron to the liver by the portal vein.
23640881 Iron efflux from human brain microvasculature endothelial cells ferroportin requires the action of an exocytoplasmic ferroxidase which can be either endogenous hephaestin or extracellular ceruloplasmin.
22503983 These results support the hypothesis that hephaestin is involved in iron mobilization of iron from the intestine to circulation.
22170436 Heph is active in placenta but may not play a key role in placental iron transport.
21802403 In contrast to ceruloplasmin, hephaestin was incapable of direct oxidation of adrenaline and dopamine implying a difference in biological substrate specificities between these two homologous ferroxidases.
20587610 Observational study of gene-disease association. (HuGE Navigator)
20019163 Hephaestin is expressed in enterocytes, in the antral portion of the stomach, in the myenteric and submucous plexi, and in pancreatic beta-cells.
19452451 Repletion of copper in Caco2 cells leads to reconstitution of hephaestin protein expression, activity, and transepithelial iron transport.
18022819 stable complex between these Cp and Hp and Tf does not occur under the experimental conditions used
17486601 Results suggest the possibility that FPN-1 might associate and interact with Heph in the process of iron exit across the basolateral membrane of intestinal absorptive cell.
More...

AA Sequence

MESGHLLWALLFMQSLWPQLTDGATRVYYLGIRDVQWNYAPKGRNVITNQPLDSDIVASSFLKSDKNRIG      1 - 70
GTYKKTIYKEYKDDSYTDEVAQPAWLGFLGPVLQAEVGDVILIHLKNFATRPYTIHPHGVFYEKDSEGSL     71 - 140
YPDGSSGPLKADDSVPPGGSHIYNWTIPEGHAPTDADPACLTWIYHSHVDAPRDIATGLIGPLITCKRGA    141 - 210
LDGNSPPQRQDVDHDFFLLFSVVDENLSWHLNENIATYCSDPASVDKEDETFQESNRMHAINGFVFGNLP    211 - 280
ELNMCAQKRVAWHLFGMGNEIDVHTAFFHGQMLTTRGHHTDVANIFPATFVTAEMVPWEPGTWLISCQVN    281 - 350
SHFRDGMQALYKVKSCSMAPPVDLLTGKVRQYFIEAHEIQWDYGPMGHDGSTGKNLREPGSISDKFFQKS    351 - 420
SSRIGGTYWKVRYEAFQDETFQEKMHLEEDRHLGILGPVIRAEVGDTIQVVFYNRASQPFSMQPHGVFYE    421 - 490
KDYEGTVYNDGSSYPGLVAKPFEKVTYRWTVPPHAGPTAQDPACLTWMYFSAADPIRDTNSGLVGPLLVC    491 - 560
RAGALGADGKQKGVDKEFFLLFTVLDENKSWYSNANQAAAMLDFRLLSEDIEGFQDSNRMHAINGFLFSN    561 - 630
LPRLDMCKGDTVAWHLLGLGTETDVHGVMFQGNTVQLQGMRKGAAMLFPHTFVMAIMQPDNLGTFEIYCQ    631 - 700
AGSHREAGMRAIYNVSQCPGHQATPRQRYQAARIYYIMAEEVEWDYCPDRSWEREWHNQSEKDSYGYIFL    701 - 770
SNKDGLLGSRYKKAVFREYTDGTFRIPRPRTGPEEHLGILGPLIKGEVGDILTVVFKNNASRPYSVHAHG    771 - 840
VLESTTVWPLAAEPGEVVTYQWNIPERSGPGPNDSACVSWIYYSAVDPIKDMYSGLVGPLAICQKGILEP    841 - 910
HGGRSDMDREFALLFLIFDENKSWYLEENVATHGSQDPGSINLQDETFLESNKMHAINGKLYANLRGLTM    911 - 980
YQGERVAWYMLAMGQDVDLHTIHFHAESFLYRNGENYRADVVDLFPGTFEVVEMVASNPGTWLMHCHVTD    981 - 1050
HVHAGMETLFTVFSRTEHLSPLTVITKETEKAVPPRDIEEGNVKMLGMQIPIKNVEMLASVLVAISVTLL   1051 - 1120
LVVLALGGVVWYQHRQRKLRRNRRSILDDSFKLLSFKQ                                   1121 - 1158
//

Text Mined References (30)

PMID Year Title
24988611 2014 [Ceruloplasmin, hephaestin and zyklopen: the three multicopper oxidases important for human iron metabolism].
23640881 2013 Ferroportin and exocytoplasmic ferroxidase activity are required for brain microvascular endothelial cell iron efflux.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22961397 2012 Functional role of the putative iron ligands in the ferroxidase activity of recombinant human hephaestin.
22666411 2012 An X chromosome association scan of the Norfolk Island genetic isolate provides evidence for a novel migraine susceptibility locus at Xq12.
22503983 2012 Iron repletion relocalizes hephaestin to a proximal basolateral compartment in polarized MDCK and Caco2 cells.
22170436 2012 Ferroportin 1 and hephaestin expression in BeWo cell line with different iron treatment.
21802403 2011 Oxidation of organic and biogenic amines by recombinant human hephaestin expressed in Pichia pastoris.
20932654 2010 Genome-wide association study to identify single nucleotide polymorphisms (SNPs) associated with the development of erectile dysfunction in African-American men after radiotherapy for prostate cancer.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
More...