Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.46
PubTator Score 3.68

Knowledge Summary

Patent

No data available

AA Sequence

MQRVGNTFSNESRVASRCPSVGLAERNRVATMPVRLLRDSPAAQEDNDHARDGFQMKLDAHGFAPEELVV      1 - 70
QVDGQWLMVTGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAMTCCLTPSGQLWVRGQCVALALPEAQ     71 - 140
TGPSPRLGSLGSKASNLTR                                                       141 - 159
//

Text Mined References (8)

PMID Year Title
19464326 2009 HSPB7 is a SC35 speckle resident small heat shock protein.
15503857 2004 Testis-specific human small heat shock protein HSPB9 is a cancer/testis antigen, and potentially interacts with the dynein subunit TCTEL1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12820654 2003 The human genome encodes 10 alpha-crystallin-related small heat shock proteins: HspB1-10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11470154 2001 Characterization of two novel human small heat shock proteins: protein kinase-related HspB8 and testis-specific HspB9.
5503857 1970 [Leiomyoma and leiomyosarcoma of the small intestine. Value of selective angiography].