Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.54
PubTator Score 3.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Mulibrey nanism 13 4.265 2.1

AA Sequence

MQRVGNTFSNESRVASRCPSVGLAERNRVATMPVRLLRDSPAAQEDNDHARDGFQMKLDAHGFAPEELVV      1 - 70
QVDGQWLMVTGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAMTCCLTPSGQLWVRGQCVALALPEAQ     71 - 140
TGPSPRLGSLGSKASNLTR                                                       141 - 159
//

Text Mined References (8)

PMID Year Title