Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.25
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
12788067 molecular cloning and structure

AA Sequence

MAEQLALVIGGTIGGLLLLLLIGASCCLWRRFCATLTYEELPGTPAMATTAASSGQRDRPCQPHARTQLS      1 - 70
RPPAVPFVVPPTLQGRDWVPLHSGEWADAPWDPCPASELLPHTSSGGLGDACMVGAINPELYKFPEDKSE     71 - 140
TDFPDGCLGRLWFSVEYEQEAERLLVGLIKAQHLQAPSETCSPLVKLYLLPDERRFLQSKTKRKTSNPQF    141 - 210
DEHFIFQVSSKTITQRVLKFSVYHVDRQRKHQLLGQVLFPLKNETLVGDCRRVIWRDLEAESLEPPSEFG    211 - 280
DLQFCLSYNDYLSRLTVVVLRAKGLRLQEDRGIVSVFVKVSLMNHNKFVKCKKTSAVLGSINPVYNETFS    281 - 350
FKADATELDTASLSLTVVQNMEGDKSQQLGRVVVGPYMYTRGRELEHWDEMLSKPKELVKRWHALCRTTE    351 - 420
P//

Text Mined References (8)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12788067 2003 Molecular cloning and characterization of human, rat, and mouse synaptotagmin XV.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11739399 2002 Synaptotagmins: why so many?
11543631 2001 Genomic analysis of synaptotagmin genes.