Property Summary

NCBI Gene PubMed Count 7
PubMed Score 159.37
PubTator Score 28.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 2.8e-38
Atopic dermatitis 952 4.0e-03
Disease Target Count Z-score Confidence
Cholecystitis 18 3.516 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
Atopic dermatitis 1.100 4.0e-03
psoriasis 2.600 2.8e-38

Gene RIF (3)

AA Sequence

MRRPAAVPLLLLLCFGSQRAKAATACGRPRMLNRMVGGQDTQEGEWPWQVSIQRNGSHFCGGSLIAEQWV      1 - 70
LTAAHCFRNTSETSLYQVLLGARQLVQPGPHAMYARVRQVESNPLYQGTASSADVALVELEAPVPFTNYI     71 - 140
LPVCLPDPSVIFETGMNCWVTGWGSPSEEDLLPEPRILQKLAVPIIDTPKCNLLYSKDTEFGYQPKTIKN    141 - 210
DMLCAGFEEGKKDACKGDSGGPLVCLVGQSWLQAGVISWGEGCARQNRPGVYIRVTAHHNWIHRIIPKLQ    211 - 280
FQPARLGGQK                                                                281 - 290
//

Text Mined References (7)

PMID Year Title