Property Summary

NCBI Gene PubMed Count 7
PubMed Score 7.79
PubTator Score 7.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Liver carcinoma 240
Disease Target Count P-value
ovarian cancer 8519 2.0e-11
osteosarcoma 7950 3.6e-05

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.295 3.6e-05
ovarian cancer 1.300 2.0e-11

Synonym

Accession Q9BQQ7 A2RRP6
Symbols LTM1
TMEM7
Z3CXXC3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MAGDTEVWKQMFQELMREVKPWHRWTLRPDKGLLPNVLKPGWMQYQQWTFARFQCSSCSRNWASAQVLVL      1 - 70
FHMNWSEEKSRGQVKMRVFTQRCKKCPQPLFEDPEFTQENISRILKNLVFRILKKCYRGRFQLIEEVPMI     71 - 140
KDISLEGPHNSDNCEACLQGFCAGPIQVTSLPPSQTPRVHSIYKVEEVVKPWASGENVYSYACQNHICRN    141 - 210
LSIFCCCVILIVIVVIVVKTAI                                                    211 - 232
//

Text Mined References (8)

PMID Year Title