Property Summary

NCBI Gene PubMed Count 7
PubMed Score 7.79
PubTator Score 7.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.295 0.000
ovarian cancer 1.300 0.000

Gene RIF (3)

PMID Text
20175129 A common genetic variant, rs7430431 in the receptor transporting protein 3 (RTP3) gene, was identified in strong association with structural instability.
20175129 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17693185 Loss of TMEM7 is associated with hepatocellular carcinoma

AA Sequence

MAGDTEVWKQMFQELMREVKPWHRWTLRPDKGLLPNVLKPGWMQYQQWTFARFQCSSCSRNWASAQVLVL      1 - 70
FHMNWSEEKSRGQVKMRVFTQRCKKCPQPLFEDPEFTQENISRILKNLVFRILKKCYRGRFQLIEEVPMI     71 - 140
KDISLEGPHNSDNCEACLQGFCAGPIQVTSLPPSQTPRVHSIYKVEEVVKPWASGENVYSYACQNHICRN    141 - 210
LSIFCCCVILIVIVVIVVKTAI                                                    211 - 232
//

Text Mined References (8)

PMID Year Title
20175129 2010 Genome-wide association study for femoral neck bone geometry.
17693185 2007 The interferon-alpha responsive gene TMEM7 suppresses cell proliferation and is downregulated in human hepatocellular carcinoma.
16720576 2006 Members of RTP and REEP gene families influence functional bitter taste receptor expression.
16271481 2005 Inherited ACTH insensitivity illuminates the mechanisms of ACTH action.
15550249 2004 RTP family members induce functional expression of mammalian odorant receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11896456 2002 The transcriptional map of the common eliminated region 1 (C3CER1) in 3p21.3.