Property Summary

NCBI Gene PubMed Count 43
PubMed Score 35.05
PubTator Score 48.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytoma 1.500 9.8e-03
posterior fossa group A ependymoma 1.100 2.2e-08
sonic hedgehog group medulloblastoma -1.200 1.6e-06
tuberculosis 1.200 2.7e-06

Gene RIF (21)

AA Sequence

MGLGVSAEQPAGGAEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLE      1 - 70
VFNMKTMRVREVEVVPSNMWGGQGLLGASVRFCSFRRASEQVWHVLDVEPSSPAALAGLRPYTDYVVGSD     71 - 140
QILQESEDFFTLIESHEGKPLKLMVYNSKSDSCREVTVTPNAAWGGEGSLGCGIGYGYLHRIPTQPPSYH    141 - 210
KKPPGTPPPSALPLGAPPPDALPPGPTPEDSPSLETGSRQSDYMEALLQAPGSSMEDPLPGPGSPSHSAP    211 - 280
DPDGLPHFMETPLQPPPPVQRVMDPGFLDVSGISLLDNSNASVWPSLPSSTELTTTAVSTSGPEDICSSS    281 - 350
SSHERGGEATWSGSEFEVSFLDSPGAQAQADHLPQLTLPDSLTSAASPEDGLSAELLEAQAEEEPASTEG    351 - 420
LDTGTEAEGLDSQAQISTTE                                                      421 - 440
//

Text Mined References (47)

PMID Year Title