Property Summary

NCBI Gene PubMed Count 40
Grant Count 27
R01 Count 24
Funding $1,859,812.87
PubMed Score 34.79
PubTator Score 48.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytoma 1.500 0.010
tuberculosis 1.200 0.000
posterior fossa group A ependymoma 1.100 0.000
sonic hedgehog group medulloblastoma -1.200 0.000

Gene RIF (19)

PMID Text
26538023 In cells, Mena and actin were required for Golgi ribbon formation after nocodazole washout; in vitro, Mena and microfilaments enhanced GRASP65 oligomerization and Golgi membrane fusion. Thus Mena interacts with GRASP65 to promote local actin polymerization, which facilitates Golgi ribbon linking.
26363069 Mutagenesis experiments support these structural observations and demonstrate that they are required for GRASP65-GM130 association.
24227884 Cisternal-specific functions of GRASP65 and GRASP55 in continuity, compartmentalization, and function of the Golgi ribbon.
23552074 propose that GRASP55/65 are negative regulators of exocytic transport and that this slowdown helps to ensure more complete protein glycosylation in the Golgi stack and proper sorting at the trans-Golgi network
21567396 HIV-1 Nef causes the FMS N-glycosylation defect and induces relocalization of the GM130 by activating the p56Hck/MEK/ERK/GRASP65 phosphorylation cascade in the Golgi
21368855 The C-terminal fragments of GRASP65 produced following caspase cleavage are targeted to mitochondria, and ectopic expression of these sensitises HeLa cells to Fas ligand.
20937827 the mechanism of phosphoinhibition as direct inhibition by PLK1 of the PDZ ligand underlying the GRASP65 self-interaction.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20214750 GRASP65 has a role in Golgi cisternal stacking and cell cycle progression
20083603 These results demonstrate that GRASP55 and GRASP65 stack mammalian Golgi cisternae via a common mechanism.
More...

AA Sequence

MGLGVSAEQPAGGAEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLE      1 - 70
VFNMKTMRVREVEVVPSNMWGGQGLLGASVRFCSFRRASEQVWHVLDVEPSSPAALAGLRPYTDYVVGSD     71 - 140
QILQESEDFFTLIESHEGKPLKLMVYNSKSDSCREVTVTPNAAWGGEGSLGCGIGYGYLHRIPTQPPSYH    141 - 210
KKPPGTPPPSALPLGAPPPDALPPGPTPEDSPSLETGSRQSDYMEALLQAPGSSMEDPLPGPGSPSHSAP    211 - 280
DPDGLPHFMETPLQPPPPVQRVMDPGFLDVSGISLLDNSNASVWPSLPSSTELTTTAVSTSGPEDICSSS    281 - 350
SSHERGGEATWSGSEFEVSFLDSPGAQAQADHLPQLTLPDSLTSAASPEDGLSAELLEAQAEEEPASTEG    351 - 420
LDTGTEAEGLDSQAQISTTE                                                      421 - 440
//

Text Mined References (44)

PMID Year Title
26538023 2016 Mena-GRASP65 interaction couples actin polymerization to Golgi ribbon linking.
26363069 2015 Structural basis for the interaction between the Golgi reassembly-stacking protein GRASP65 and the Golgi matrix protein GM130.
25416956 2014 A proteome-scale map of the human interactome network.
24564958 2014 Variability in the common genetic architecture of social-communication spectrum phenotypes during childhood and adolescence.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24227884 2014 Isoform-specific tethering links the Golgi ribbon to maintain compartmentalization.
23552074 2013 Regulation of protein glycosylation and sorting by the Golgi matrix proteins GRASP55/65.
21572988 2011 An OBSL1-Cul7Fbxw8 ubiquitin ligase signaling mechanism regulates Golgi morphology and dendrite patterning.
21368855 2010 Caspase cleavage of the Golgi stacking factor GRASP65 is required for Fas/CD95-mediated apoptosis.
20937827 2010 Mitotic inhibition of GRASP65 organelle tethering involves Polo-like kinase 1 (PLK1) phosphorylation proximate to an internal PDZ ligand.
More...