Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.13
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 3.95913081588399E-10
diabetes mellitus 1663 0.00135732104365388
medulloblastoma, large-cell 6234 0.00176338248228462
Disease Target Count Z-score Confidence
Melanoma 261 0.0 1.0
Disease Target Count Z-score Confidence
Otitis media 32 3.362 1.7

AA Sequence

MMCPLWRLLIFLGLLALPLAPHKQPWPGLAQAHRDNKSTLARIIAQGLIKHNAESRIQNIHFGDRLNASA      1 - 70
QVAPGLVGWLISGRKHQQQQESSINITNIQLDCGGIQISFHKEWFSANISLEFDLELRPSFDNNIVKMCA     71 - 140
HMSIVVEFWLEKDEFGRRDLVIGKCDAEPSSVHVAILTEAIPPKMNQFLYNLKENLQKVLPHMVESQVCP    141 - 210
LIGEILGQLDVKLLKSLIEQEAAHEPTHHETSQPSACQAGESPS                              211 - 254
//

Text Mined References (6)

PMID Year Title
21787333 2011 Systematic nomenclature for the PLUNC/PSP/BSP30/SMGB proteins as a subfamily of the BPI fold-containing superfamily.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14739326 2004 Phylogenetic and evolutionary analysis of the PLUNC gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11971875 2002 PLUNC: a novel family of candidate host defence proteins expressed in the upper airways and nasopharynx.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.