Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.13
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
ovarian cancer 8520 4.0e-10
diabetes mellitus 1728 1.4e-03
medulloblastoma, large-cell 6241 1.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Melanoma 711 0.0 1.1
Disease Target Count Z-score Confidence
Otitis Media 52 3.384 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus 1.300 1.4e-03
medulloblastoma, large-cell 1.100 1.8e-03
ovarian cancer 1.100 4.0e-10

 GO Function (1)

 GO Component (1)

 GWAS Trait (1)

 HCA RNA Cell Line (1)

AA Sequence

MMCPLWRLLIFLGLLALPLAPHKQPWPGLAQAHRDNKSTLARIIAQGLIKHNAESRIQNIHFGDRLNASA      1 - 70
QVAPGLVGWLISGRKHQQQQESSINITNIQLDCGGIQISFHKEWFSANISLEFDLELRPSFDNNIVKMCA     71 - 140
HMSIVVEFWLEKDEFGRRDLVIGKCDAEPSSVHVAILTEAIPPKMNQFLYNLKENLQKVLPHMVESQVCP    141 - 210
LIGEILGQLDVKLLKSLIEQEAAHEPTHHETSQPSACQAGESPS                              211 - 254
//

Text Mined References (6)

PMID Year Title