Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.97
PubTator Score 6.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Gene RIF (6)

AA Sequence

MKMKLFQTICRQLRSSKFSVESAALVAFSTSSYSCGRKKKVNPYEEVDQEKYSNLVQSVLSSRGVAQTPG      1 - 70
SVEEDALLCGPVSKHKLPNQGEDRRVPQNWFPIFNPERSDKPNASDPSVPLKIPLQRNVIPSVTRVLQQT     71 - 140
MTKQQVFLLERWKQRMILELGEDGFKEYTSNVFLQGKRFHEALESILSPQETLKERDENLLKSGYIESVQ    141 - 210
HILKDVSGVRALESAVQHETLNYIGLLDCVAEYQGKLCVIDWKTSEKPKPFIQSTFDNPLQVVAYMGAMN    211 - 280
HDTNYSFQVQCGLIVVAYKDGSPAHPHFMDAELCSQYWTKWLLRLEEYTEKKKNQNIQKPEYSE          281 - 344
//

Text Mined References (18)

PMID Year Title