Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.56
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.100 1.4e-03
atypical teratoid / rhabdoid tumor -1.100 1.2e-07
diabetes mellitus 1.200 1.4e-03
glioblastoma -1.100 2.6e-05
interstitial cystitis -1.200 7.3e-04
medulloblastoma, large-cell -1.200 1.4e-04
nasopharyngeal carcinoma -1.400 1.6e-02
non-small cell lung cancer 2.063 1.7e-08
periodontitis -1.400 1.5e-27
spina bifida -1.203 3.6e-02

AA Sequence

MFGGPGPGVLGAQGMAGPLRGRVEELKLPWWRESSPLVLRHSEAARLAADALLERGEAAYLRVISEEREL      1 - 70
PFLSALDVDYMTSHVRGGPELSEAQGQEASGPDRLSLLSEVTSGTYFPMASDIDPPDLDLGWPEVPQATG     71 - 140
FSPTQAVVHFQRDKAKNIKDLLRFLFSQAHTVVAVVMDIFTDMELLCDLMEASSRRGVPVYLLLAQEHLR    141 - 210
HFLEMCYKMDLNGEHLPNMRVRSTCGDTYCSKAGRRFTGQALEKFVLIDCEQVVAGSYSFTWLCSQAHTS    211 - 280
MVLQLRGRIVEDFDREFRCLYAESQPVEGFCGGEDPLSPRALRPPPVALAFRPDVPSPTSSLPSSTSLSS    281 - 350
IKQSPLMGRSSYLALPGGGDCSDTGVVSSSLGPARREASGQPSLHRQLSDPNHGSPPGLYRANLGKLGAY    351 - 420
PWSQSSPALNHNSTSPLTLAVGSPLLPRSRPLLQFHRGAPALSRFPENGLPGSQEPSPLRGRWVPGTTLE    421 - 490
TVEEKEKKASPSQSRGQLDLLVPFPRAREVGDPDSGVTPNSGPLRPGEQAPEDRRLSPSQADSQLDLLSR    491 - 560
ALGTGGAPELGSLRPGDRALEDRRLSLNQSRGQSDLLMQYPKAQGSRVPLETNSSARPARRAPDERRQTL    561 - 630
GHSQLDLITKFGPFRGEGPGPNGLPISSPARTAGAGSGDEKRLTLGHSKLDLITKYHQLHGARQGTEPGG    631 - 700
PKGGHLNGGNSDLVRDEKRLTLGHSKLDLITKYNKSKFKQLRSRFES                           701 - 747
//

Text Mined References (6)

PMID Year Title