Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.06
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
periodontitis -1.400 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.100 0.000
medulloblastoma, large-cell -1.200 0.000
non-small cell lung cancer 2.063 0.000
diabetes mellitus 1.200 0.001
interstitial cystitis -1.200 0.001
adult high grade glioma -1.100 0.001
nasopharyngeal carcinoma -1.400 0.016
spina bifida -1.203 0.036

Synonym

Accession Q9BQN1 Q14D67 Q5JWN6 Q8N276
Symbols C20orf128
dJ614O4.7

Gene

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MFGGPGPGVLGAQGMAGPLRGRVEELKLPWWRESSPLVLRHSEAARLAADALLERGEAAYLRVISEEREL      1 - 70
PFLSALDVDYMTSHVRGGPELSEAQGQEASGPDRLSLLSEVTSGTYFPMASDIDPPDLDLGWPEVPQATG     71 - 140
FSPTQAVVHFQRDKAKNIKDLLRFLFSQAHTVVAVVMDIFTDMELLCDLMEASSRRGVPVYLLLAQEHLR    141 - 210
HFLEMCYKMDLNGEHLPNMRVRSTCGDTYCSKAGRRFTGQALEKFVLIDCEQVVAGSYSFTWLCSQAHTS    211 - 280
MVLQLRGRIVEDFDREFRCLYAESQPVEGFCGGEDPLSPRALRPPPVALAFRPDVPSPTSSLPSSTSLSS    281 - 350
IKQSPLMGRSSYLALPGGGDCSDTGVVSSSLGPARREASGQPSLHRQLSDPNHGSPPGLYRANLGKLGAY    351 - 420
PWSQSSPALNHNSTSPLTLAVGSPLLPRSRPLLQFHRGAPALSRFPENGLPGSQEPSPLRGRWVPGTTLE    421 - 490
TVEEKEKKASPSQSRGQLDLLVPFPRAREVGDPDSGVTPNSGPLRPGEQAPEDRRLSPSQADSQLDLLSR    491 - 560
ALGTGGAPELGSLRPGDRALEDRRLSLNQSRGQSDLLMQYPKAQGSRVPLETNSSARPARRAPDERRQTL    561 - 630
GHSQLDLITKFGPFRGEGPGPNGLPISSPARTAGAGSGDEKRLTLGHSKLDLITKYHQLHGARQGTEPGG    631 - 700
PKGGHLNGGNSDLVRDEKRLTLGHSKLDLITKYNKSKFKQLRSRFES                           701 - 747
//

Text Mined References (6)

PMID Year Title
24736947 2014 Conserved oncogenic behavior of the FAM83 family regulates MAPK signaling in human cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.