Property Summary

NCBI Gene PubMed Count 62
PubMed Score 97.72
PubTator Score 102.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Poikiloderma of Kindler 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Melanoma 711 0.0 0.5
Disease Target Count Z-score Confidence
Kindler syndrome 11 8.411 4.0

Expression

  Differential Expression (25)

Disease log2 FC p
adrenocortical carcinoma -1.120 3.1e-02
adult high grade glioma 1.700 2.5e-04
astrocytic glioma 2.900 1.3e-03
Astrocytoma, Pilocytic 2.600 8.8e-08
Breast cancer -2.000 2.0e-09
colon cancer 1.600 6.9e-03
cystic fibrosis 1.115 2.5e-04
ependymoma 1.100 1.3e-03
glioblastoma 1.400 1.9e-03
interstitial cystitis -2.500 1.5e-03
intraductal papillary-mucinous adenoma (... 2.500 4.0e-04
intraductal papillary-mucinous carcinoma... 2.200 4.9e-03
intraductal papillary-mucinous neoplasm ... 2.900 2.4e-03
lung adenocarcinoma 1.900 8.6e-10
lung cancer 3.700 8.4e-06
malignant mesothelioma -3.800 5.9e-08
medulloblastoma, large-cell 1.300 8.4e-05
nasopharyngeal carcinoma 1.500 9.4e-05
non-small cell lung cancer 3.298 2.1e-25
oligodendroglioma 3.100 3.3e-03
osteosarcoma 1.804 1.2e-03
ovarian cancer -1.300 9.6e-05
pancreatic cancer 1.700 8.2e-07
pancreatic ductal adenocarcinoma liver m... 2.115 2.0e-02
psoriasis 1.300 2.0e-06

Protein-protein Interaction (5)

Gene RIF (54)

AA Sequence

MLSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQINISQDWSDFALWWEQKHCWL      1 - 70
LKTHWTLDKYGVQADAKLLFTPQHKMLRLRLPNLKMVRLRVSFSAVVFKAVSDICKILNIRRSEELSLLK     71 - 140
PSGDYFKKKKKKDKNNKEPIIEDILNLESSPTASGSSVSPGLYSKTMTPIYDPINGTPASSTMTWFSDSP    141 - 210
LTEQNCSILAFSQPPQSPEALADMYQPRSLVDKAKLNAGWLDSSRSLMEQGIQEDEQLLLRFKYYSFFDL    211 - 280
NPKYDAVRINQLYEQARWAILLEEIDCTEEEMLIFAALQYHISKLSLSAETQDFAGESEVDEIEAALSNL    281 - 350
EVTLEGGKADSLLEDITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPLEKLNL    351 - 420
RGCEVVPDVNVAGRKFGIKLLIPVADGMNEMYLRCDHENQYAQWMAACMLASKGKTMADSSYQPEVLNIL    421 - 490
SFLRMKNRNSASQVASSLENMDMNPECFVSPRCAKRHKSKQLAARILEAHQNVAQMPLVEAKLRFIQAWQ    491 - 560
SLPEFGLTYYLVRFKGSKKDDILGVSYNRLIKIDAATGIPVTTWRFTNIKQWNVNWETRQVVIEFDQNVF    561 - 630
TAFTCLSADCKIVHEYIGGYIFLSTRSKDQNETLDEDLFHKLTGGQD                           631 - 677
//

Text Mined References (67)

PMID Year Title