Property Summary

NCBI Gene PubMed Count 8
PubMed Score 23.06
PubTator Score 11.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Lipodystrophy 32 3.525 1.8

Expression

Synonym

Accession Q9BQK8 B2RTT5 Q5TDB9 Q9NPY8 Q9UJE5
Symbols SMP2
LIPN3L

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Zebrafish OMA EggNOG
C. elegans OMA EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Gene RIF (3)

PMID Text
23263658 a newly identified novel cell-penetrating sequence (LPIN; RRKRRRRRK) from the nuclear localization sequence (NLS) of human nuclear phosphatase, LPIN3.
22481384 LPIN1-related myolysis constitutes a major cause of early-onset rhabdomyolysis and occasionally in adults. Heterozygous LPIN1 mutations may cause mild muscular symptoms. No major defects of LPIN2 or LPIN3 genes were associated with muscle manifestations.
20735359 Data revealed that lipin 1 formed stable homo-oligomers with itself and hetero-oligomers with lipin 2/3.

AA Sequence

MNYVGQLAETVFGTVKELYRGLNPATLSGGIDVLVVKQVDGSFRCSPFHVRFGKLGVLRSREKVVDIELN      1 - 70
GEPVDLHMKLGDSGEAFFVQELESDDEHVPPGLCTSPIPWGGLSGFPSDSQLGTASEPEGLVMAGTASTG     71 - 140
RRKRRRRRKPKQKEDAVATDSSPEELEAGAESELSLPEKLRPEPPGVQLEEKSSLQPKDIYPYSDGEWPP    141 - 210
QASLSAGELTSPKSDSELEVRTPEPSPLRAESHMQWAWGRLPKVARAERPESSVVLEGRAGATSPPRGGP    211 - 280
STPSTSVAGGVDPLGLPIQQTEAGADLQPDTEDPTLVGPPLHTPETEESKTQSSGDMGLPPASKSWSWAT    281 - 350
LEVPVPTGQPERVSRGKGSPKRSQHLGPSDIYLDDLPSLDSENAALYFPQSDSGLGARRWSEPSSQKSLR    351 - 420
DPNPEHEPEPTLDTVDTIALSLCGGLADSRDISLEKFNQHSVSYQDLTKNPGLLDDPNLVVKINGKHYNW    421 - 490
AVAAPMILSLQAFQKNLPKSTMDKLEREKMPRKGGRWWFSWRRRDFLAEERSAQKEKTAAKEQQGEKTEV    491 - 560
LSSDDDAPDSPVILEIPSLPPSTPPSTPTYKKSLRLSSDQIRRLNLQEGANDVVFSVTTQYQGTCRCKAT    561 - 630
IYLWKWDDKVVISDIDGTITKSDALGHILPQLGKDWTHQGITSLYHKIQLNGYKFLYCSARAIGMADLTK    631 - 700
GYLQWVSEGGCSLPKGPILLSPSSLFSALHREVIEKKPEVFKVACLSDIQQLFLPHGQPFYAAFGNRPND    701 - 770
VFAYRQVGLPESRIFTVNPRGELIQELIKNHKSTYERLGEVVELLFPPVARGPSTDLANPEYSNFCYWRE    771 - 840
PLPAVDLDTLD                                                               841 - 851
//

Text Mined References (12)

PMID Year Title
23263658 2012 Identification of a novel cell-penetrating peptide from human phosphatidate phosphatase LPIN3.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22481384 2012 Study of LPIN1, LPIN2 and LPIN3 in rhabdomyolysis and exercise-induced myalgia.
20735359 2010 Lipin proteins form homo- and hetero-oligomers.
18694939 2008 Temporal and spatial regulation of the phosphatidate phosphatases lipin 1 and 2.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17158099 2007 Three mammalian lipins act as phosphatidate phosphatases with distinct tissue expression patterns.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
More...