Property Summary

NCBI Gene PubMed Count 15
Grant Count 4
R01 Count 4
Funding $336,999.5
PubMed Score 3.33
PubTator Score 4.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Gene RIF (3)

PMID Text
21881001 TM4SF10, possibly through ADAP, may regulate Fyn activity
15345028 Single nucleotide polymorphisms, but no disease-associated mutations, were identified in X-linked mental retardation patients.
11472633 A 4-transmembrane protein, related to PMP22/EMPs and the Claudins, localizes to the plasma membrane and the ER. The mRNA is present in high amounts in brain.

AA Sequence

MASAGSGMEEVRVSVLTPLKLVGLVCIFLALCLDLGAVLSPAWVTADHQYYLSLWESCRKPASLDIWHCE      1 - 70
STLSSDWQIATLALLLGGAAIILIAFLVGLISICVGSRRRFYRPVAVMLFAAVVLQVCSLVLYPIKFIET     71 - 140
VSLKIYHEFNWGYGLAWGATIFSFGGAILYCLNPKNYEDYY                                 141 - 181
//

Text Mined References (17)

PMID Year Title
26990309 2016 Vertebrate Claudin/PMP22/EMP22/MP20 family protein TMEM47 regulates epithelial cell junction maturation and morphogenesis.
24603971 2014 Detection of chromosomal breakpoints in patients with developmental delay and speech disorders.
23412934 2013 A genome-wide association study of brain lesion distribution in multiple sclerosis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21881001 2011 TM4SF10 and ADAP interaction in podocytes: role in Fyn activity and nephrin phosphorylation.
18056173 2007 Novel markers of subclinical disease for Ewing family tumors from gene expression profiling.
16381901 2006 The LIFEdb database in 2006.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...