Tdark | Nuclear receptor-interacting protein 2 |
Down-regulates transcriptional activation by nuclear receptors such as NR1F2.
Comments
Disease | Target Count | P-value |
---|---|---|
posterior fossa group A ependymoma | 1511 | 1.26577903200848E-6 |
atypical teratoid / rhabdoid tumor | 4369 | 3.18031157926211E-5 |
psoriasis | 6685 | 5.44771105694265E-4 |
glioblastoma | 5572 | 0.00160936864329242 |
pilocytic astrocytoma | 3086 | 0.00366397558270743 |
adult high grade glioma | 2148 | 0.00391920699587259 |
colon cancer | 1475 | 0.00750345262386311 |
sonic hedgehog group medulloblastoma | 1482 | 0.0106082018587683 |
subependymal giant cell astrocytoma | 2287 | 0.0138434621292008 |
medulloblastoma, large-cell | 6234 | 0.0494028274070879 |
Disease | log2 FC | p |
---|---|---|
psoriasis | -1.500 | 0.001 |
glioblastoma | -1.500 | 0.002 |
atypical teratoid / rhabdoid tumor | -1.600 | 0.000 |
medulloblastoma, large-cell | -1.300 | 0.049 |
colon cancer | -1.100 | 0.008 |
adult high grade glioma | -1.500 | 0.004 |
pilocytic astrocytoma | -1.100 | 0.004 |
posterior fossa group A ependymoma | -1.300 | 0.000 |
sonic hedgehog group medulloblastoma | 2.000 | 0.011 |
subependymal giant cell astrocytoma | -1.842 | 0.014 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG |
Pig | OMA EggNOG |
Opossum | OMA EggNOG Inparanoid |
MLFIFPLSLPWRPSCWKESCSTGQRQAGRSREDSVTPPPSSPWPTPPAGAMSTKQEARRDEGEARTRGQE 1 - 70 AQLRDRAHLSQQRRLKQATQFLHKDSADLLPLDSLKRLGTSKDLQPRSVIQRRLVEGNPNWLQGEPPRMQ 71 - 140 DLIHGQESRRKTSRTEIPALLVNCKCQDQLLRVAVDTGTQYNRISAGCLSRLGLEKRVLKASAGDLAPGP 141 - 210 PTQVEQLELQLGQETVVCSAQVVDAESPEFCLGLQTLLSLKCCIDLEHGVLRLKAPFSELPFLPLYQEPG 211 - 280 Q//
PMID | Year | Title |
---|---|---|
25416956 | 2014 | A proteome-scale map of the human interactome network. |
17075290 | 2006 | Association of the RIP2 gene with childhood atopic asthma. |
16541075 | 2006 | The finished DNA sequence of human chromosome 12. |
16381901 | 2006 | The LIFEdb database in 2006. |
16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. |
15489336 | 2004 | From ORFeome to biology: a functional genomics pipeline. |
15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. |
12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. |
11256614 | 2000 | Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing. |
More... |