Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.500 3.9e-03
atypical teratoid / rhabdoid tumor -1.600 3.2e-05
colon cancer -1.100 7.5e-03
glioblastoma -1.100 1.9e-04
medulloblastoma, large-cell -1.300 4.9e-02
Pilocytic astrocytoma -1.100 3.7e-03
posterior fossa group A ependymoma -1.300 1.3e-06
psoriasis -1.500 5.4e-04
sonic hedgehog group medulloblastoma 2.000 1.1e-02
subependymal giant cell astrocytoma -1.842 1.4e-02

Gene RIF (1)

AA Sequence

MLFIFPLSLPWRPSCWKESCSTGQRQAGRSREDSVTPPPSSPWPTPPAGAMSTKQEARRDEGEARTRGQE      1 - 70
AQLRDRAHLSQQRRLKQATQFLHKDSADLLPLDSLKRLGTSKDLQPRSVIQRRLVEGNPNWLQGEPPRMQ     71 - 140
DLIHGQESRRKTSRTEIPALLVNCKCQDQLLRVAVDTGTQYNRISAGCLSRLGLEKRVLKASAGDLAPGP    141 - 210
PTQVEQLELQLGQETVVCSAQVVDAESPEFCLGLQTLLSLKCCIDLEHGVLRLKAPFSELPFLPLYQEPG    211 - 280
Q//

Text Mined References (13)

PMID Year Title