Property Summary

NCBI Gene PubMed Count 9
PubMed Score 13.41
PubTator Score 7.03

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.700 1.9e-03
Astrocytoma, Pilocytic -1.100 6.0e-04
atypical teratoid / rhabdoid tumor -3.100 2.4e-06
glioblastoma -2.000 9.1e-06
group 3 medulloblastoma -2.100 3.2e-06
medulloblastoma, large-cell -3.200 1.2e-07
oligodendroglioma 1.100 2.2e-02
osteosarcoma 1.053 9.8e-05
psoriasis -1.400 6.1e-18
subependymal giant cell astrocytoma -2.717 5.4e-03

Gene RIF (2)

AA Sequence

MEEDKLLSAVPEEGDATRDPGPEPEEEPGVRNGMASEGLNSSLCSPGHERRGTPADTEEPTKDPDVAFHG      1 - 70
LSLGLSLTNGLALGPDLNILEDSAESRPWRAGVLAEGDNASRSLYPDAEDPQLGLDGPGEPDVRDGFSAT     71 - 140
FEKILESELLRGTQYSSLDSLDGLSLTDESDSCVSFEAPLTPLIQQRARDSPEPGAGLGIGDMAFEGDMG    141 - 210
AAGGDGELGSPLRRSISSSRSENVLSRLSLMAMPNGFHEDGPQGPGGDEDDDEEDTDKLLNSASDPSLKD    211 - 280
GLSDSDSELSSSEGLEPGSADPLANGCQGVSEAAHRLARRLYHLEGFQRCDVARQLGKNNEFSRLVAGEY    281 - 350
LSFFDFSGLTLDGALRTFLKAFPLMGETQERERVLTHFSRRYCQCNPDDSTSEDGIHTLTCALMLLNTDL    351 - 420
HGHNIGKKMSCQQFIANLDQLNDGQDFAKDLLKTLYNSIKNEKLEWAIDEDELRKSLSELVDDKFGTGTK    421 - 490
KVTRILDGGNPFLDVPQALSATTYKHGVLTRKTHADMDGKRTPRGRRGWKKFYAVLKGTILYLQKDEYRP    491 - 560
DKALSEGDLKNAIRVHHALATRASDYSKKSNVLKLKTADWRVFLFQAPSKEEMLSWILRINLVAAIFSAP    561 - 630
AFPAAVSSMKKFCRPLLPSCTTRLCQEEQLRSHENKLRQLTAELAEHRCHPVERGIKSKEAEEYRLKEHY    631 - 700
LTFEKSRYETYIHLLAMKIKVGSDDLERIEARLATLEGDDPSLRKTHSSPALSQGHVTGSKTTKDATGPD    701 - 770
T//

Text Mined References (12)

PMID Year Title