Property Summary

NCBI Gene PubMed Count 4
PubMed Score 8.04
PubTator Score 2.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.800 0.010
oligodendroglioma -1.100 0.000
glioblastoma -1.100 0.004
adrenocortical carcinoma 1.781 0.000
pilocytic astrocytoma -1.400 0.002
subependymal giant cell astrocytoma -1.920 0.046
Pick disease -1.500 0.000
pituitary cancer 1.100 0.001

Synonym

Accession Q9BQI6 B4DMG4 Q3B7K4 Q6NSA5 Q6PHW9 Q9Y402
Symbols BRCTx
BRCTD1
ANKRD32

Gene

PANTHER Protein Class (1)

Gene RIF (1)

PMID Text
15632077 Results describe the cloning, characterization, and targeted mutagenesis of Brctx, a novel gene with a BRCT motif [Brctx].

AA Sequence

MEDGTPKHIIQMTGFKMEEKEALVKLLLKLDCTFIKSEKYKNCTHLIAERLCKSEKFLAACAAGKWILTK      1 - 70
DYIIHSAKSGRWLDETTYEWGYKIEKDSRYSPQMQSAPKRWREELKRTGAPGAFHRWKVVLLVRTDKRSD     71 - 140
SLIRVLEAGKANVILPKSSPSGITHVIASNARIKAEKEKDNFKAPFYPIQYLGDFLLEKEIQNDEDSQTN    141 - 210
SVWTEHSNEETNKDFRKDAGFLEMKGALRETMYRTQKEMQNHEDVNVGSILIQHHKKEKFSGSSKDLKFV    211 - 280
KMRNTFGSHTYENQKEIKKKDEDIQRSYTLRRKRKKGKESNCKKGVEHEKIKSTLRRHIYNRDQKEMKNS    281 - 350
IFAEYAKESKAMAIKTDVDVVEIKNTLRKHIYRAQAVRYNCIRIDKQPVYNVEVKNAEFPRGVLNLIESL    351 - 420
IEGHFFKEAIEELSTLQAHYIPPVCVLHALLENVLQDNIDTFSGRYFHILSALLHLHPPWKSPAMSRYYL    421 - 490
ELFQCPTCMKGAWSLVEVLIRSCLFNESFCHQISENIGSKVLHLTLLKFFFNLIESEVQHLSQKLYDWSD    491 - 560
SQNLKITGKAMLLEIFWSGSETSGLLTKPVNMLLEWTIYSHKEKFKSNDVFKHELAYLLAGILGAAIDYW    561 - 630
IFLGLKMGRNVMRHMSDDLGSYVSLSCDDFSSQELEIFICSFSSSWLQMFVAEAVFKKLCLQSSGSVSSE    631 - 700
PLSLQKMVYSYLPALGKTGVLGSGKIQVSKKIGQRPCFDSQRTLLMLNGTKQKQVEGLPELLDLNLAKCS    701 - 770
SSLKKLKKKSEGELSCSKENCPSVVKKMNFHKTNLKGETALHRACINNQVEKLILLLSLPGIDINVKDNA    771 - 840
GWTPLHEACNYGNTVCVQEILQRCPEVDLLTQVDGVTPLHDALSNGHVEIGKLLLQHGGPVLLQQRNAKG    841 - 910
ELPLDYVVSPQIKEELFAITKIEDTVENFHAQAEKHFHYQQLEFGSFLLSRMLLNFCSIFDLSSEFILAS    911 - 980
KGLTHLNELLMACKSHKETTSVHTDWLLDLYAGNIKTLQKLPHILKELPENLKVCPGVHTEALMITLEMM    981 - 1050
CRSVMEFS                                                                 1051 - 1058
//

Text Mined References (10)

PMID Year Title
25931565 2015 DNA repair. Proteomics reveals dynamic assembly of repair complexes during bypass of DNA cross-links.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15632077 2005 BRCTx is a novel, highly conserved RAD18-interacting protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.