Property Summary

NCBI Gene PubMed Count 21
PubMed Score 5.19
PubTator Score 6.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
non-small cell lung carcinoma 413 1.75119604558565E-22
astrocytoma 1493 2.95002465750325E-22
posterior fossa group A ependymoma 1511 3.24197391858901E-21
atypical teratoid / rhabdoid tumor 4369 1.10536473646803E-9
pediatric high grade glioma 2712 1.3610105367231E-6
pituitary cancer 1972 2.86919906948713E-6
glioblastoma 5572 6.42171716604648E-6
medulloblastoma, large-cell 6234 6.48026820634469E-6
Pick disease 1893 5.53639425441571E-5
pilocytic astrocytoma 3086 9.35920308233928E-5
primitive neuroectodermal tumor 3031 1.68956172726709E-4
interstitial cystitis 2299 2.36639349604564E-4
group 3 medulloblastoma 2254 3.28294811335572E-4
oligodendroglioma 2849 0.00800851005925171
Alzheimer's disease 644 0.0191053617967945
subependymal giant cell astrocytoma 2287 0.0435565292605098
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Disease of mental health 22 0.0 1.0
Disease Target Count Z-score Confidence
Alcohol dependence 107 3.295 1.6

Expression

  Differential Expression (16)

Gene

PDB

5AWT   5AWU   5AWR   5AWS  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (8)

PMID Text
21407171 Our results show association between genetic variants in SGIP1 and fat mass. We provide evidence that variation in SGIP1 is a potentially important determinant of obesity-related traits in humans
21317682 The earlier implicated single nucleotide polymorphisms located in SGIP1 gene showed no association with alcohol dependence or theta electroencephalogram power.
20946875 SGIP1 and the signaling adaptor Reps1 interact with ITSN1 in vivo.
20421487 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)
17626015 SGIP1alpha plays an essential role in clathrin-mediated endocytosis by interacting with phospholipids and Eps15.

AA Sequence

MMEGLKKRTRKAFGIRKKEKDTDSTGSPDRDGIQPSPHEPPYNSKAECAREGGKKVSKKSNGAPNGFYAE      1 - 70
IDWERYNSPELDEEGYSIRPEEPGSTKGKHFYSSSESEEEEESHKKFNIKIKPLQSKDILKNAATVDELK     71 - 140
ASIGNIALSPSPVRKSPRRSPGAIKRNLSSEEVARPRRSTPTPELISKKPPDDTTALAPLFGPPLESAFD    141 - 210
EQKTEVLLDQPEIWGSGQPINPSMESPKLTRPFPTGTPPPLPPKNVPATPPRTGSPLTIGPGNDQSATEV    211 - 280
KIEKLPSINDLDSIFGPVLSPKSVAVNAEEKWVHFSDTSPEHVTPELTPREKVVSPPATPDNPADSPAPG    281 - 350
PLGPPGPTGPPGPPGPPRNVLSPLNLEEVQKKVAEQTFIKDDYLETISSPKDFGLGQRATPPPPPPPTYR    351 - 420
TVVSSPGPGSGPGPGTTSGASSPARPATPLVPCRSTTPPPPPPRPPSRPKLPPGKPGVGDVSRPFSPPIH    421 - 490
SSSPPPIAPLARAESTSSISSTNSLSAATTPTVENEQPSLVWFDRGKFYLTFEGSSRGPSPLTMGAQDTL    491 - 560
PVAAAFTETVNAYFKGADPSKCIVKITGEMVLSFPAGITRHFANNPSPAALTFRVINFSRLEHVLPNPQL    561 - 630
LCCDNTQNDANTKEFWVNMPNLMTHLKKVSEQKPQATYYNVDMLKYQVSAQGIQSTPLNLAVNWRCEPSS    631 - 700
TDLRIDYKYNTDAMTTAVALNNVQFLVPIDGGVTKLQAVLPPAVWNAEQQRILWKIPDISQKSENGGVGS    701 - 770
LLARFQLSEGPSKPSPLVVQFTSEGSTLSGCDIELVGAGYRFSLIKKRFAAGKYLADN                771 - 828
//

Text Mined References (22)

PMID Year Title
23509613 2013 Genome-wide association study of antiphospholipid antibodies.
23307926 2013 A genome-wide association study of early menopause and the combined impact of identified variants.
21407171 2012 Genetic variation in SH3-domain GRB2-like (endophilin)-interacting protein 1 has a major impact on fat mass.
21317682 2011 Nonreplication of an association of SGIP1 SNPs with alcohol dependence and resting theta EEG power.
20946875 2010 Intersectin 1 forms complexes with SGIP1 and Reps1 in clathrin-coated pits.
20421487 2010 Genome-wide association identifies candidate genes that influence the human electroencephalogram.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...