Property Summary

NCBI Gene PubMed Count 23
PubMed Score 5.35
PubTator Score 6.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -2.300 1.8e-05
Alzheimer's disease -1.200 1.9e-02
astrocytic glioma -1.500 6.1e-03
Astrocytoma, Pilocytic -1.400 6.4e-05
atypical teratoid / rhabdoid tumor -3.900 1.1e-09
ependymoma -2.900 1.0e-02
glioblastoma -2.600 1.2e-08
group 3 medulloblastoma -2.800 3.3e-04
interstitial cystitis 2.500 2.4e-04
medulloblastoma, large-cell -3.600 6.5e-06
non-small cell lung carcinoma -1.100 1.8e-22
oligodendroglioma -2.000 8.0e-03
Pick disease -2.000 5.5e-05
pituitary cancer 1.900 2.9e-06
primitive neuroectodermal tumor -2.800 1.7e-04
subependymal giant cell astrocytoma -2.123 4.4e-02

Gene RIF (10)

AA Sequence

MMEGLKKRTRKAFGIRKKEKDTDSTGSPDRDGIQPSPHEPPYNSKAECAREGGKKVSKKSNGAPNGFYAE      1 - 70
IDWERYNSPELDEEGYSIRPEEPGSTKGKHFYSSSESEEEEESHKKFNIKIKPLQSKDILKNAATVDELK     71 - 140
ASIGNIALSPSPVRKSPRRSPGAIKRNLSSEEVARPRRSTPTPELISKKPPDDTTALAPLFGPPLESAFD    141 - 210
EQKTEVLLDQPEIWGSGQPINPSMESPKLTRPFPTGTPPPLPPKNVPATPPRTGSPLTIGPGNDQSATEV    211 - 280
KIEKLPSINDLDSIFGPVLSPKSVAVNAEEKWVHFSDTSPEHVTPELTPREKVVSPPATPDNPADSPAPG    281 - 350
PLGPPGPTGPPGPPGPPRNVLSPLNLEEVQKKVAEQTFIKDDYLETISSPKDFGLGQRATPPPPPPPTYR    351 - 420
TVVSSPGPGSGPGPGTTSGASSPARPATPLVPCRSTTPPPPPPRPPSRPKLPPGKPGVGDVSRPFSPPIH    421 - 490
SSSPPPIAPLARAESTSSISSTNSLSAATTPTVENEQPSLVWFDRGKFYLTFEGSSRGPSPLTMGAQDTL    491 - 560
PVAAAFTETVNAYFKGADPSKCIVKITGEMVLSFPAGITRHFANNPSPAALTFRVINFSRLEHVLPNPQL    561 - 630
LCCDNTQNDANTKEFWVNMPNLMTHLKKVSEQKPQATYYNVDMLKYQVSAQGIQSTPLNLAVNWRCEPSS    631 - 700
TDLRIDYKYNTDAMTTAVALNNVQFLVPIDGGVTKLQAVLPPAVWNAEQQRILWKIPDISQKSENGGVGS    701 - 770
LLARFQLSEGPSKPSPLVVQFTSEGSTLSGCDIELVGAGYRFSLIKKRFAAGKYLADN                771 - 828
//

Text Mined References (24)

PMID Year Title