Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.17
PubTator Score 2.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.200 9.3e-03
breast carcinoma -2.300 1.6e-03
cystic fibrosis -1.700 2.4e-05
ductal carcinoma in situ -1.900 9.4e-04
ependymoma -1.700 6.8e-04
fibroadenoma -2.400 3.4e-02
group 4 medulloblastoma -1.400 4.2e-04
interstitial cystitis 1.300 5.8e-05
intraductal papillary-mucinous adenoma (... -1.900 1.6e-04
intraductal papillary-mucinous carcinoma... -1.900 2.7e-03
intraductal papillary-mucinous neoplasm ... -2.400 2.7e-04
invasive ductal carcinoma -2.400 1.8e-03
oligodendroglioma -1.100 2.6e-02
osteosarcoma 2.641 3.1e-05
ovarian cancer 1.200 1.4e-03

Gene RIF (1)

AA Sequence

MLRQLLLAALCLAGPPAPARACQLPSEWRPLSEGCRAELAETIVYARVLALHPEAPGLYNHLPWQYHAGQ      1 - 70
GGLFYSAEVEMLCDQAWGSMLEVPAGSRLNLTGLGYFSCHSHTVVQDYSYFFFLRMDENYNLLPHGVNFQ     71 - 140
DAIFPDTQENRRMFSSLFQFSNCSQGQQLATFSSDWEIQEDSRLMCSSVQKALFEEEDHVKKLQQKVATL    141 - 210
EKRNRQLRERVKKVKRSLRQARKKGRHLELANQKLSEKLAAGALPHINARGPVRPPYLRG              211 - 270
//

Text Mined References (14)

PMID Year Title