Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.44
PubTator Score 2.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma -1.300 0.000
ependymoma -1.700 0.001
oligodendroglioma -1.300 0.000
osteosarcoma 2.641 0.000
group 4 medulloblastoma -1.400 0.000
intraductal papillary-mucinous adenoma (... -1.900 0.000
intraductal papillary-mucinous carcinoma... -1.900 0.003
intraductal papillary-mucinous neoplasm ... -2.400 0.000
breast carcinoma -2.300 0.002
fibroadenoma -2.400 0.034
interstitial cystitis 1.300 0.000
cystic fibrosis -1.700 0.000
ductal carcinoma in situ -1.900 0.001
invasive ductal carcinoma -2.400 0.002
ovarian cancer 1.200 0.001

Gene RIF (1)

PMID Text
25193116 CCDC3 represses TNF-alpha/NF-kappaB-induced pro-inflammatory response in endothelial cells.

AA Sequence

MLRQLLLAALCLAGPPAPARACQLPSEWRPLSEGCRAELAETIVYARVLALHPEAPGLYNHLPWQYHAGQ      1 - 70
GGLFYSAEVEMLCDQAWGSMLEVPAGSRLNLTGLGYFSCHSHTVVQDYSYFFFLRMDENYNLLPHGVNFQ     71 - 140
DAIFPDTQENRRMFSSLFQFSNCSQGQQLATFSSDWEIQEDSRLMCSSVQKALFEEEDHVKKLQQKVATL    141 - 210
EKRNRQLRERVKKVKRSLRQARKKGRHLELANQKLSEKLAAGALPHINARGPVRPPYLRG              211 - 270
//

Text Mined References (14)

PMID Year Title
25193116 2014 Coiled-coil domain containing 3 (CCDC3) represses tumor necrosis factor-?/nuclear factor ?B-induced endothelial inflammation.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20526338 2010 Genome-wide meta-analyses identifies seven loci associated with platelet aggregation in response to agonists.
20043878 2010 Identification of a new secretory factor, CCDC3/Favine, in adipocytes and endothelial cells.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...