Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.44
PubTator Score 2.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
astrocytoma 1493 7.36961388319468E-22
oligodendroglioma 2849 6.44708282849567E-15
cystic fibrosis 1670 2.44506415375997E-5
osteosarcoma 7933 3.14846751266149E-5
interstitial cystitis 2299 5.79282277062098E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.63845262895657E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 2.72053943647587E-4
group 4 medulloblastoma 1875 4.20060023994798E-4
ependymoma 2514 6.78629457172287E-4
ductal carcinoma in situ 1745 9.3588557585838E-4
ovarian cancer 8492 0.00137675806683606
breast carcinoma 1614 0.00157370740679422
invasive ductal carcinoma 2950 0.00180244174661073
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00272090642972895
fibroadenoma 557 0.0340209359814842

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma -1.300 0.000
ependymoma -1.700 0.001
oligodendroglioma -1.300 0.000
osteosarcoma 2.641 0.000
group 4 medulloblastoma -1.400 0.000
intraductal papillary-mucinous adenoma (... -1.900 0.000
intraductal papillary-mucinous carcinoma... -1.900 0.003
intraductal papillary-mucinous neoplasm ... -2.400 0.000
breast carcinoma -2.300 0.002
fibroadenoma -2.400 0.034
interstitial cystitis 1.300 0.000
cystic fibrosis -1.700 0.000
ductal carcinoma in situ -1.900 0.001
invasive ductal carcinoma -2.400 0.002
ovarian cancer 1.200 0.001

Synonym

Accession Q9BQI4 Q5VYV8 Q5VYV9
Symbols

Gene

  Ortholog (12)

 GWAS Trait (1)

Pathway (1)

Gene RIF (1)

PMID Text
25193116 CCDC3 represses TNF-alpha/NF-kappaB-induced pro-inflammatory response in endothelial cells.

AA Sequence

MLRQLLLAALCLAGPPAPARACQLPSEWRPLSEGCRAELAETIVYARVLALHPEAPGLYNHLPWQYHAGQ      1 - 70
GGLFYSAEVEMLCDQAWGSMLEVPAGSRLNLTGLGYFSCHSHTVVQDYSYFFFLRMDENYNLLPHGVNFQ     71 - 140
DAIFPDTQENRRMFSSLFQFSNCSQGQQLATFSSDWEIQEDSRLMCSSVQKALFEEEDHVKKLQQKVATL    141 - 210
EKRNRQLRERVKKVKRSLRQARKKGRHLELANQKLSEKLAAGALPHINARGPVRPPYLRG              211 - 270
//

Text Mined References (14)

PMID Year Title
25193116 2014 Coiled-coil domain containing 3 (CCDC3) represses tumor necrosis factor-?/nuclear factor ?B-induced endothelial inflammation.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20526338 2010 Genome-wide meta-analyses identifies seven loci associated with platelet aggregation in response to agonists.
20043878 2010 Identification of a new secretory factor, CCDC3/Favine, in adipocytes and endothelial cells.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...