Property Summary

Ligand Count 3
NCBI Gene PubMed Count 27
PubMed Score 96.66
PubTator Score 69.99

Knowledge Summary

Patent (16,614)

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.300 2.7e-02
esophageal adenocarcinoma 1.200 2.0e-02
group 3 medulloblastoma 1.100 7.9e-05
invasive ductal carcinoma 1.200 3.0e-03
lung adenocarcinoma 1.333 3.6e-11
lung cancer 2.200 8.8e-03
Multiple myeloma 1.109 9.7e-03
osteosarcoma -1.397 6.4e-03
ovarian cancer 2.200 2.6e-05

Gene RIF (10)

AA Sequence

MQGGNSGVRKREEEGDGAGAVAAPPAIDFPAEGPDPEYDESDVPAEIQVLKEPLQQPTFPFAVANQLLLV      1 - 70
SLLEHLSHVHEPNPLRSRQVFKLLCQTFIKMGLLSSFTCSDEFSSLRLHHNRAITHLMRSAKERVRQDPC     71 - 140
EDISRIQKIRSREVALEAQTSRYLNEFEELAILGKGGYGRVYKVRNKLDGQYYAIKKILIKGATKTVCMK    141 - 210
VLREVKVLAGLQHPNIVGYHTAWIEHVHVIQPRADRAAIELPSLEVLSDQEEDREQCGVKNDESSSSSII    211 - 280
FAEPTPEKEKRFGESDTENQNNKSVKYTTNLVIRESGELESTLELQENGLAGLSASSIVEQQLPLRRNSH    281 - 350
LEESFTSTEESSEENVNFLGQTEAQYHLMLHIQMQLCELSLWDWIVERNKRGREYVDESACPYVMANVAT    351 - 420
KIFQELVEGVFYIHNMGIVHRDLKPRNIFLHGPDQQVKIGDFGLACTDILQKNTDWTNRNGKRTPTHTSR    421 - 490
VGTCLYASPEQLEGSEYDAKSDMYSLGVVLLELFQPFGTEMERAEVLTGLRTGQLPESLRKRCPVQAKYI    491 - 560
QHLTRRNSSQRPSAIQLLQSELFQNSGNVNLTLQMKIIEQEKEIAELKKQLNLLSQDKGVRDDGKDGGVG    561 - 630
//

Text Mined References (31)

PMID Year Title