Property Summary

NCBI Gene PubMed Count 25
Grant Count 10
R01 Count 8
Funding $2,163,278.04
PubMed Score 86.50
PubTator Score 69.99

Knowledge Summary

Patent (16,614)

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.109 0.010
esophageal adenocarcinoma 1.200 0.020
osteosarcoma -1.397 0.006
astrocytoma 1.300 0.027
lung cancer 2.200 0.009
group 3 medulloblastoma 1.100 0.000
lung adenocarcinoma 1.333 0.000
invasive ductal carcinoma 1.200 0.003
ovarian cancer 2.200 0.000

Gene RIF (8)

PMID Text
23874749 Infection-associated functions of HRI (an eIF2alpha kinase) are independent of its activity as a regulator of protein synthesis.
23392680 Dephosphorylation of eIF2alpha, specifically in the cortex, is both correlated with and necessary for normal memory consolidation.
23357686 During lead-stress, the regulation of hHRI mRNA translation is mediated through its 5'-untranslated region (UTR) that interacts with specific trans-acting factors.
20198315 Observational study of gene-disease association. (HuGE Navigator)
20071449 eukaryotic initiation factor 2alpha kinase is a protagonist of heme-mediated translational control of CYP2B enzymes and a modulator of basal endoplasmic reticulum stress tone.
19851296 Observational study of gene-disease association. (HuGE Navigator)
19133234 These data establish for the first time, the possible mechanisms of regulation of hHRI gene expression under normal physiological condition, hemin exposure and stress.
12767237 autophosphorylation of Thr485 is essential for the hyperphosphorylation and activation of HRI and is required for the acquisition of the eIF2alpha kinase activity

AA Sequence

MQGGNSGVRKREEEGDGAGAVAAPPAIDFPAEGPDPEYDESDVPAEIQVLKEPLQQPTFPFAVANQLLLV      1 - 70
SLLEHLSHVHEPNPLRSRQVFKLLCQTFIKMGLLSSFTCSDEFSSLRLHHNRAITHLMRSAKERVRQDPC     71 - 140
EDISRIQKIRSREVALEAQTSRYLNEFEELAILGKGGYGRVYKVRNKLDGQYYAIKKILIKGATKTVCMK    141 - 210
VLREVKVLAGLQHPNIVGYHTAWIEHVHVIQPRADRAAIELPSLEVLSDQEEDREQCGVKNDESSSSSII    211 - 280
FAEPTPEKEKRFGESDTENQNNKSVKYTTNLVIRESGELESTLELQENGLAGLSASSIVEQQLPLRRNSH    281 - 350
LEESFTSTEESSEENVNFLGQTEAQYHLMLHIQMQLCELSLWDWIVERNKRGREYVDESACPYVMANVAT    351 - 420
KIFQELVEGVFYIHNMGIVHRDLKPRNIFLHGPDQQVKIGDFGLACTDILQKNTDWTNRNGKRTPTHTSR    421 - 490
VGTCLYASPEQLEGSEYDAKSDMYSLGVVLLELFQPFGTEMERAEVLTGLRTGQLPESLRKRCPVQAKYI    491 - 560
QHLTRRNSSQRPSAIQLLQSELFQNSGNVNLTLQMKIIEQEKEIAELKKQLNLLSQDKGVRDDGKDGGVG    561 - 630
//

Text Mined References (29)

PMID Year Title
23874749 2013 The host-encoded Heme Regulated Inhibitor (HRI) facilitates virulence-associated activities of bacterial pathogens.
23392680 2013 Blocking the eIF2? kinase (PKR) enhances positive and negative forms of cortex-dependent taste memory.
23357686 2013 Vimentin is a component of a complex that binds to the 5'-UTR of human heme-regulated eIF2? kinase mRNA and regulates its translation.
21269460 2011 Initial characterization of the human central proteome.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20071449 2010 Hepatic heme-regulated inhibitor (HRI) eukaryotic initiation factor 2alpha kinase: a protagonist of heme-mediated translational control of CYP2B enzymes and a modulator of basal endoplasmic reticulum stress tone.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19133234 2009 Stress-induced overexpression of the heme-regulated eIF-2alpha kinase is regulated by Elk-1 activated through ERK pathway.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...