Property Summary

NCBI Gene PubMed Count 16
PubMed Score 20.77
PubTator Score 17.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (2)

AA Sequence

MSGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLM      1 - 70
SLKRMMEKLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGP     71 - 140
PPERDIASLP                                                                141 - 150
//

Text Mined References (21)

PMID Year Title