Property Summary

NCBI Gene PubMed Count 16
Grant Count 5
R01 Count 5
Funding $251,579.85
PubMed Score 20.10
PubTator Score 17.83

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)
18699778 Structure of human Iba2 and its homodimerization properties, F-actin cross-linking activity, cellular localization and recruitment upon bacterial invasion in comparison with Iba1.

AA Sequence

MSGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLM      1 - 70
SLKRMMEKLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGP     71 - 140
PPERDIASLP                                                                141 - 150
//

Text Mined References (21)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18699778 2008 Structural and functional characterization of human Iba proteins.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
More...