Property Summary

NCBI Gene PubMed Count 18
PubMed Score 0.97
PubTator Score 2.17

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
interstitial cystitis -1.200 6.4e-03
intraductal papillary-mucinous neoplasm ... 1.300 1.5e-02
osteosarcoma -1.328 2.7e-02
ovarian cancer -1.100 5.6e-04
pancreatic ductal adenocarcinoma liver m... -1.346 4.5e-03
ulcerative colitis -1.300 1.1e-03

Protein-protein Interaction (6)

Gene RIF (2)

AA Sequence

MSSVKRSLKQEIVTQFHCSAAEGDIAKLTGILSHSPSLLNETSENGWTALMYAARNGHPEIVQFLLEKGC      1 - 70
DRSIVNKSRQTALDIAVFWGYKHIANLLATAKGGKKPWFLTNEVEECENYFSKTLLDRKSEKRNNSDWLL     71 - 140
AKESHPATVFILFSDLNPLVTLGGNKESFQQPEVRLCQLNYTDIKDYLAQPEKITLIFLGVELEIKDKLL    141 - 210
NYAGEVPREEEDGLVAWFALGIDPIAAEEFKQRHENCYFLHPPMPALLQLKEKEAGVVAQARSVLAWHSR    211 - 280
YKFCPTCGNATKIEEGGYKRLCLKEDCPSLNGVHNTSYPRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMF    281 - 350
TCLAGFIEPGETIEDAVRREVEEESGVKVGHVQYVACQPWPMPSSLMIGCLALAVSTEIKVDKNEIEDAR    351 - 420
WFTREQVLDVLTKGKQQAFFVPPSRAIAHQLIKHWIRINPNL                                421 - 462
//

Text Mined References (18)

PMID Year Title