Property Summary

NCBI Gene PubMed Count 15
Grant Count 15
R01 Count 10
Funding $4,130,034.57
PubMed Score 26.74
PubTator Score 5.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
ependymoma 1.900 0.006
osteosarcoma 2.625 0.000
group 4 medulloblastoma 2.300 0.000
atypical teratoid / rhabdoid tumor 1.100 0.005
medulloblastoma, large-cell 1.300 0.001
primitive neuroectodermal tumor 1.900 0.000
Pick disease -1.100 0.001
progressive supranuclear palsy -1.200 0.022
Gaucher disease type 1 -1.200 0.025

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
434973 screening 4906 / 0 / 326853 uHTS Luminescent assay for identification of inhibitors of Sentrin-specific protease 7 (SENP7)
434986 summary 0 / 0 / 0 Summary assay for identification of inhibitors of Sentrin-specific protease 7 (SENP7)
488904 confirmatory 692 / 0 / 12 Dose Response confirmation of uHTS for inhibitors of Sentrin-specific protease 7 (SENP7) using a Luminescent assay
488917 screening 4283 / 0 / 1913 Single concentration confirmation of uHTS for inhibitors of Sentrin-specific protease 7 (SENP7) using a Luminescent assay
489001 summary 0 / 0 / 0 Summary assay for identification of pan-SENP inhibitors
504497 confirmatory 142 / 0 / 125 SAR Analysis of small molecule inhibitors of Sentrin-specific protease 7 (SENP7) using a Luminescent assay
588600 confirmatory 47 / 0 / 54 SAR Analysis of small molecule inhibitors of Sentrin-specific protease 7 (SENP7) using a Luminescent assay - Set 2

Gene RIF (5)

PMID Text
25895136 c-Myc is targeted to the proteasome for degradation in a SUMOylation-dependent manner, regulated by PIAS1, SENP7 and RNF4
24018422 deSUMOylation by SENP7 is required to promote a permissive chromatin environment for DNA repair.
23045645 differential splicing of the SENP7 regulates either tumor suppression or progression
21878624 Loop 1 insertion in SENP6 and SENP7 as a platform to discriminate between SUMO1 and SUMO2/3 isoforms in this subclass of the SUMO protease family.
18799455 SENP6 and SENP7 exhibit lower rates for processing pre-SUMO1, pre-SUMO2, or pre-SUMO3 in comparison with SENP2

AA Sequence

MDKRKLGRRPSSSEIITEGKRKKSSSDLSEIRKMLNAKPEDVHVQSPLSKFRSSERWTLPLQWERSLRNK      1 - 70
VISLDHKNKKHIRGCPVTSKSSPERQLKVMLTNVLWTDLGRKFRKTLPRNDANLCDANKVQSDSLPSTSV     71 - 140
DSLETCQKLEPLRQSLNLSERIPRVILTNVLGTELGRKYIRTPPVTEGSLSDTDNLQSEQLSSSSDGSLE    141 - 210
SYQNLNPHKSCYLSERGSQRSKTVDDNSAKQTAHNKEKRRKDDGISLLISDTQPEDLNSGSRGCDHLEQE    211 - 280
SRNKDVKYSDSKVELTLISRKTKRRLRNNLPDSQYCTSLDKSTEQTKKQEDDSTISTEFEKPSENYHQDP    281 - 350
KLPEEITTKPTKSDFTKLSSLNSQELTLSNATKSASAGSTTETVENSNSIDIVGISSLVEKDENELNTIE    351 - 420
KPILRGHNEGNQSLISAEPIVVSSDEEGPVEHKSSEILKLQSKQDRETTNENESTSESALLELPLITCES    421 - 490
VQMSSELCPYNPVMENISSIMPSNEMDLQLDFIFTSVYIGKIKGASKGCVTITKKYIKIPFQVSLNEISL    491 - 560
LVDTTHLKRFGLWKSKDDNHSKRSHAILFFWVSSDYLQEIQTQLEHSVLSQQSKSSEFIFLELHNPVSQR    561 - 630
EELKLKDIMTEISIISGELELSYPLSWVQAFPLFQNLSSKESSFIHYYCVSTCSFPAGVAVAEEMKLKSV    631 - 700
SQPSNTDAAKPTYTFLQKQSSGCYSLSITSNPDEEWREVRHTGLVQKLIVYPPPPTKGGLGVTNEDLECL    701 - 770
EEGEFLNDVIIDFYLKYLILEKASDELVERSHIFSSFFYKCLTRKENNLTEDNPNLSMAQRRHKRVRTWT    771 - 840
RHINIFNKDYIFVPVNESSHWYLAVICFPWLEEAVYEDFPQTVSQQSQAQQSQNDNKTIDNDLRTTSTLS    841 - 910
LSAEDSQSTESNMSVPKKMCKRPCILILDSLKAASVQNTVQNLREYLEVEWEVKLKTHRQFSKTNMVDLC    911 - 980
PKVPKQDNSSDCGVYLLQYVESFFKDPIVNFELPIHLEKWFPRHVIKTKREDIRELILKLHLQQQKGSSS    981 - 1050
//

Text Mined References (21)

PMID Year Title
25895136 2015 c-Myc is targeted to the proteasome for degradation in a SUMOylation-dependent manner, regulated by PIAS1, SENP7 and RNF4.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24018422 2013 The deSUMOylase SENP7 promotes chromatin relaxation for homologous recombination DNA repair.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23045645 2012 Differential expression of SUMO-specific protease 7 variants regulates epithelial-mesenchymal transition.
21878624 2011 Swapping small ubiquitin-like modifier (SUMO) isoform specificity of SUMO proteases SENP6 and SENP7.
20562864 2010 Human POGZ modulates dissociation of HP1alpha from mitotic chromosome arms through Aurora B activation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18799455 2008 Structure of the human SENP7 catalytic domain and poly-SUMO deconjugation activities for SENP6 and SENP7.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...