Property Summary

NCBI Gene PubMed Count 16
PubMed Score 28.39
PubTator Score 5.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 4.9e-03
ependymoma 1.900 5.9e-03
Gaucher disease type 1 -1.200 2.5e-02
group 3 medulloblastoma 1.600 7.7e-03
malignant mesothelioma 1.400 1.4e-04
medulloblastoma, large-cell 1.300 1.0e-03
osteosarcoma 2.625 7.8e-05
Pick disease -1.100 6.2e-04
primitive neuroectodermal tumor 1.900 7.4e-06
progressive supranuclear palsy -1.200 2.2e-02

Gene RIF (5)

AA Sequence

MDKRKLGRRPSSSEIITEGKRKKSSSDLSEIRKMLNAKPEDVHVQSPLSKFRSSERWTLPLQWERSLRNK      1 - 70
VISLDHKNKKHIRGCPVTSKSSPERQLKVMLTNVLWTDLGRKFRKTLPRNDANLCDANKVQSDSLPSTSV     71 - 140
DSLETCQKLEPLRQSLNLSERIPRVILTNVLGTELGRKYIRTPPVTEGSLSDTDNLQSEQLSSSSDGSLE    141 - 210
SYQNLNPHKSCYLSERGSQRSKTVDDNSAKQTAHNKEKRRKDDGISLLISDTQPEDLNSGSRGCDHLEQE    211 - 280
SRNKDVKYSDSKVELTLISRKTKRRLRNNLPDSQYCTSLDKSTEQTKKQEDDSTISTEFEKPSENYHQDP    281 - 350
KLPEEITTKPTKSDFTKLSSLNSQELTLSNATKSASAGSTTETVENSNSIDIVGISSLVEKDENELNTIE    351 - 420
KPILRGHNEGNQSLISAEPIVVSSDEEGPVEHKSSEILKLQSKQDRETTNENESTSESALLELPLITCES    421 - 490
VQMSSELCPYNPVMENISSIMPSNEMDLQLDFIFTSVYIGKIKGASKGCVTITKKYIKIPFQVSLNEISL    491 - 560
LVDTTHLKRFGLWKSKDDNHSKRSHAILFFWVSSDYLQEIQTQLEHSVLSQQSKSSEFIFLELHNPVSQR    561 - 630
EELKLKDIMTEISIISGELELSYPLSWVQAFPLFQNLSSKESSFIHYYCVSTCSFPAGVAVAEEMKLKSV    631 - 700
SQPSNTDAAKPTYTFLQKQSSGCYSLSITSNPDEEWREVRHTGLVQKLIVYPPPPTKGGLGVTNEDLECL    701 - 770
EEGEFLNDVIIDFYLKYLILEKASDELVERSHIFSSFFYKCLTRKENNLTEDNPNLSMAQRRHKRVRTWT    771 - 840
RHINIFNKDYIFVPVNESSHWYLAVICFPWLEEAVYEDFPQTVSQQSQAQQSQNDNKTIDNDLRTTSTLS    841 - 910
LSAEDSQSTESNMSVPKKMCKRPCILILDSLKAASVQNTVQNLREYLEVEWEVKLKTHRQFSKTNMVDLC    911 - 980
PKVPKQDNSSDCGVYLLQYVESFFKDPIVNFELPIHLEKWFPRHVIKTKREDIRELILKLHLQQQKGSSS    981 - 1050
//

Text Mined References (22)

PMID Year Title