Property Summary

NCBI Gene PubMed Count 15
PubMed Score 26.74
PubTator Score 5.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
primitive neuroectodermal tumor 3031 7.43568625717842E-6
group 4 medulloblastoma 1875 9.49296623953654E-6
osteosarcoma 7933 7.83164885674308E-5
malignant mesothelioma 3163 1.39633151080418E-4
Pick disease 1893 6.21008855582356E-4
medulloblastoma, large-cell 6234 0.00104007416548598
atypical teratoid / rhabdoid tumor 4369 0.00487348037653123
ependymoma 2514 0.00586385383845046
progressive supranuclear palsy 674 0.0223272965061142
Gaucher disease type 1 171 0.0250311637274848
Disease Target Count Z-score Confidence
Malaria 140 3.065 1.5

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
ependymoma 1.900 0.006
osteosarcoma 2.625 0.000
group 4 medulloblastoma 2.300 0.000
atypical teratoid / rhabdoid tumor 1.100 0.005
medulloblastoma, large-cell 1.300 0.001
primitive neuroectodermal tumor 1.900 0.000
Pick disease -1.100 0.001
progressive supranuclear palsy -1.200 0.022
Gaucher disease type 1 -1.200 0.025

Synonym

Gene

PDB

3EAY  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
434973 screening 4906 / 0 / 326853 uHTS Luminescent assay for identification of inhibitors of Sentrin-specific protease 7 (SENP7)
434986 summary 0 / 0 / 0 Summary assay for identification of inhibitors of Sentrin-specific protease 7 (SENP7)
488904 confirmatory 692 / 0 / 12 Dose Response confirmation of uHTS for inhibitors of Sentrin-specific protease 7 (SENP7) using a Luminescent assay
488917 screening 4283 / 0 / 1913 Single concentration confirmation of uHTS for inhibitors of Sentrin-specific protease 7 (SENP7) using a Luminescent assay
489001 summary 0 / 0 / 0 Summary assay for identification of pan-SENP inhibitors
504497 confirmatory 142 / 0 / 125 SAR Analysis of small molecule inhibitors of Sentrin-specific protease 7 (SENP7) using a Luminescent assay
588600 confirmatory 47 / 0 / 54 SAR Analysis of small molecule inhibitors of Sentrin-specific protease 7 (SENP7) using a Luminescent assay - Set 2

Gene RIF (5)

PMID Text
25895136 c-Myc is targeted to the proteasome for degradation in a SUMOylation-dependent manner, regulated by PIAS1, SENP7 and RNF4
24018422 deSUMOylation by SENP7 is required to promote a permissive chromatin environment for DNA repair.
23045645 differential splicing of the SENP7 regulates either tumor suppression or progression
21878624 Loop 1 insertion in SENP6 and SENP7 as a platform to discriminate between SUMO1 and SUMO2/3 isoforms in this subclass of the SUMO protease family.
18799455 SENP6 and SENP7 exhibit lower rates for processing pre-SUMO1, pre-SUMO2, or pre-SUMO3 in comparison with SENP2

AA Sequence

MDKRKLGRRPSSSEIITEGKRKKSSSDLSEIRKMLNAKPEDVHVQSPLSKFRSSERWTLPLQWERSLRNK      1 - 70
VISLDHKNKKHIRGCPVTSKSSPERQLKVMLTNVLWTDLGRKFRKTLPRNDANLCDANKVQSDSLPSTSV     71 - 140
DSLETCQKLEPLRQSLNLSERIPRVILTNVLGTELGRKYIRTPPVTEGSLSDTDNLQSEQLSSSSDGSLE    141 - 210
SYQNLNPHKSCYLSERGSQRSKTVDDNSAKQTAHNKEKRRKDDGISLLISDTQPEDLNSGSRGCDHLEQE    211 - 280
SRNKDVKYSDSKVELTLISRKTKRRLRNNLPDSQYCTSLDKSTEQTKKQEDDSTISTEFEKPSENYHQDP    281 - 350
KLPEEITTKPTKSDFTKLSSLNSQELTLSNATKSASAGSTTETVENSNSIDIVGISSLVEKDENELNTIE    351 - 420
KPILRGHNEGNQSLISAEPIVVSSDEEGPVEHKSSEILKLQSKQDRETTNENESTSESALLELPLITCES    421 - 490
VQMSSELCPYNPVMENISSIMPSNEMDLQLDFIFTSVYIGKIKGASKGCVTITKKYIKIPFQVSLNEISL    491 - 560
LVDTTHLKRFGLWKSKDDNHSKRSHAILFFWVSSDYLQEIQTQLEHSVLSQQSKSSEFIFLELHNPVSQR    561 - 630
EELKLKDIMTEISIISGELELSYPLSWVQAFPLFQNLSSKESSFIHYYCVSTCSFPAGVAVAEEMKLKSV    631 - 700
SQPSNTDAAKPTYTFLQKQSSGCYSLSITSNPDEEWREVRHTGLVQKLIVYPPPPTKGGLGVTNEDLECL    701 - 770
EEGEFLNDVIIDFYLKYLILEKASDELVERSHIFSSFFYKCLTRKENNLTEDNPNLSMAQRRHKRVRTWT    771 - 840
RHINIFNKDYIFVPVNESSHWYLAVICFPWLEEAVYEDFPQTVSQQSQAQQSQNDNKTIDNDLRTTSTLS    841 - 910
LSAEDSQSTESNMSVPKKMCKRPCILILDSLKAASVQNTVQNLREYLEVEWEVKLKTHRQFSKTNMVDLC    911 - 980
PKVPKQDNSSDCGVYLLQYVESFFKDPIVNFELPIHLEKWFPRHVIKTKREDIRELILKLHLQQQKGSSS    981 - 1050
//

Text Mined References (21)

PMID Year Title
25895136 2015 c-Myc is targeted to the proteasome for degradation in a SUMOylation-dependent manner, regulated by PIAS1, SENP7 and RNF4.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24018422 2013 The deSUMOylase SENP7 promotes chromatin relaxation for homologous recombination DNA repair.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23045645 2012 Differential expression of SUMO-specific protease 7 variants regulates epithelial-mesenchymal transition.
21878624 2011 Swapping small ubiquitin-like modifier (SUMO) isoform specificity of SUMO proteases SENP6 and SENP7.
20562864 2010 Human POGZ modulates dissociation of HP1alpha from mitotic chromosome arms through Aurora B activation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18799455 2008 Structure of the human SENP7 catalytic domain and poly-SUMO deconjugation activities for SENP6 and SENP7.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...