Property Summary

NCBI Gene PubMed Count 19
PubMed Score 6.41
PubTator Score 5.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 2.2e-06
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 50 3.819 1.9
Disease Target Count Z-score Confidence
Supravalvular aortic stenosis 12 3.216 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.544 2.2e-06

Gene RIF (6)

AA Sequence

MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKSKSNSSAAREP      1 - 70
NGFPSDASANSSLLLEFQDENSNQSSVSDVYQLKVDSSTNSSPSPQQSESLSPAHTSDFRTDDSQPPTLG     71 - 140
QEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES            141 - 202
//

Text Mined References (26)

PMID Year Title