Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MALVPGRSKEDGLWTRNSPGSSQHPESPRLPNPLWDRGKIGKVEGHQHIQVSTSSACVWQLAYPPVWPNL      1 - 70
PAVPIQDFSQKSHLPSIVVESSEVNEESGDLHLPHEELLLLTDGEEEDAEAFFQDQSEEPGWAWSPQDPR     71 - 140
SPLRTFNAGLSWGQDQDEEDACWILEDTACLEATNHCPFWDSTGSRVCRSGFVEYSHLLPPNSFEGAEEE    141 - 210
AVQTPAGVESGAASEAPGGRGCDRPRADHAAPPQEAGVQCTCQHYTVREEAQKTPPADPACPEREDSHGS    211 - 280
GSPFKASQD                                                                 281 - 289
//

Text Mined References (7)

PMID Year Title