Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Synonym

Accession Q9BQE6 Q96NA4
Symbols C11orf48

Gene

 Compartment GO Term (1)

AA Sequence

MALVPGRSKEDGLWTRNSPGSSQHPESPRLPNPLWDRGKIGKVEGHQHIQVSTSSACVWQLAYPPVWPNL      1 - 70
PAVPIQDFSQKSHLPSIVVESSEVNEESGDLHLPHEELLLLTDGEEEDAEAFFQDQSEEPGWAWSPQDPR     71 - 140
SPLRTFNAGLSWGQDQDEEDACWILEDTACLEATNHCPFWDSTGSRVCRSGFVEYSHLLPPNSFEGAEEE    141 - 210
AVQTPAGVESGAASEAPGGRGCDRPRADHAAPPQEAGVQCTCQHYTVREEAQKTPPADPACPEREDSHGS    211 - 280
GSPFKASQD                                                                 281 - 289
//

Text Mined References (5)

PMID Year Title
18828023 2009 Immunoscreening of urinary bladder cancer cDNA library and identification of potential tumor antigen.
17154719 2006 Mammalian small nucleolar RNAs are mobile genetic elements.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.