Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.99
PubTator Score 6.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
osteosarcoma 7933 1.02404638254983E-10
medulloblastoma, large-cell 6234 6.09191500815202E-6
ovarian cancer 8492 1.09080153514777E-5
atypical teratoid / rhabdoid tumor 4369 1.57895448528803E-5
psoriasis 6685 3.47536334081698E-5
glioblastoma 5572 4.05306609374311E-5
pediatric high grade glioma 2712 2.27689749536807E-4
lung cancer 4473 5.43388518151633E-4
group 4 medulloblastoma 1875 0.00113875540094545
active Crohn's disease 918 0.00123143274862018
cutaneous lupus erythematosus 1056 0.00202253641220695
active ulcerative colitis 477 0.0184333130852932
Disease Target Count Z-score Confidence
chronic kidney disease 90 0.0 2.0
Disease Target Count Z-score Confidence
Swine influenza 9 3.258 1.6
peritoneal carcinoma 4 3.02 1.5
Disease Target Count
Phencyclidine Abuse 5
Schizophrenia 503

Expression

  Differential Expression (12)

Disease log2 FC p
cutaneous lupus erythematosus 1.700 0.002
psoriasis -2.900 0.000
osteosarcoma -3.837 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
glioblastoma -1.500 0.000
medulloblastoma, large-cell -1.700 0.000
lung cancer -1.100 0.001
active Crohn's disease 1.543 0.001
active ulcerative colitis 1.311 0.018
pediatric high grade glioma -1.200 0.000
group 4 medulloblastoma -1.300 0.001
ovarian cancer -1.300 0.000

Synonym

Accession Q9BQE5 B0QYK7 O95915 Q59GW9 Q5TH96 Q969T6 Q9BT28 Q9UGT1 Q9UH10
Symbols APOL3
APOL-II

Gene

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG

Gene RIF (7)

PMID Text
24901046 Apolipoprotein L2 contains a BH3-like domain but it does not behave as a BH3-only protein.
20665705 Results reveal a novel function for ApoL2 in conferring anti-apoptotic ability of human bronchial epithelium to the cytotoxic effects of IFN-gamma, in maintaining airway epithelial layer integrity.
20602615 Observational study of gene-disease association. (HuGE Navigator)
18632255 An association of APOL1, 2 and 4 with schizophrenia was establised.
18632255 Observational study of gene-disease association. (HuGE Navigator)
15949655 Observational study of gene-disease association. (HuGE Navigator)
11944986 APOL2 has been found only in humans and African green monkeys

AA Sequence

MNPESSIFIEDYLKYFQDQVSRENLLQLLTDDEAWNGFVAAAELPRDEADELRKALNKLASHMVMKDKNR      1 - 70
HDKDQQHRQWFLKEFPRLKRELEDHIRKLRALAEEVEQVHRGTTIANVVSNSVGTTSGILTLLGLGLAPF     71 - 140
TEGISFVLLDTGMGLGAAAAVAGITCSVVELVNKLRARAQARNLDQSGTNVAKVMKEFVGGNTPNVLTLV    141 - 210
DNWYQVTQGIGRNIRAIRRARANPQLGAYAPPPHIIGRISAEGGEQVERVVEGPAQAMSRGTMIVGAATG    211 - 280
GILLLLDVVSLAYESKHLLEGAKSESAEELKKRAQELEGKLNFLTKIHEMLQPGQDQ                 281 - 337
//

Text Mined References (20)

PMID Year Title
24901046 2014 Apolipoprotein L2 contains a BH3-like domain but it does not behave as a BH3-only protein.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20665705 2011 A novel anti-apoptotic role for apolipoprotein L2 in IFN-?-induced cytotoxicity in human bronchial epithelial cells.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...