Property Summary

Ligand Count 1
NCBI Gene PubMed Count 19
PubMed Score 10.01
PubTator Score 3.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Protein-protein Interaction (4)

Gene RIF (15)

AA Sequence

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDL      1 - 70
EPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHS     71 - 140
FGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY    141 - 210
DICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEK    211 - 280
AYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG    281 - 350
FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE    351 - 420
AREDMAALEKDYEEVGADSADGEDEGEEY                                             421 - 449
//

Text Mined References (32)

PMID Year Title