Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.50
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.300 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
group 4 medulloblastoma -1.300 0.001
tuberculosis 1.500 0.000
Breast cancer 1.200 0.000
ovarian cancer 2.600 0.000

AA Sequence

MEQDDPVEALTELRERRLGALELLQAAAGSGLAAYAVWALLLQPGFRRVPLRLQVPYVGASARQVEHVLS      1 - 70
LLRGRPGKTVDLGSGDGRIVLAAHRCGLRPAVGYELNPWLVALARLHAWRAGCAGSVCYRRKDLWKVSLR     71 - 140
DCRNVSVFLAPSVLPLLEDKLRTELPAGARVVSGRFPLPTWQPVTAVGEGLDRVWAYDVPEGGQAGEAAS    141 - 210
SRIPIQAAPGPSSAPIPGGLISQAS                                                 211 - 235
//

Text Mined References (6)

PMID Year Title
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.