Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.50
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 4.54050285872896E-11
tuberculosis 1563 4.41588567707675E-9
atypical teratoid / rhabdoid tumor 4369 3.54527792943723E-7
ovarian cancer 8492 4.24692836532374E-7
psoriasis 6685 2.06076358982026E-4
group 4 medulloblastoma 1875 6.65134911396585E-4

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.300 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
group 4 medulloblastoma -1.300 0.001
tuberculosis 1.500 0.000
Breast cancer 1.200 0.000
ovarian cancer 2.600 0.000

Synonym

Accession Q9BQD7 A2IDD4
Symbols C16orf24

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

AA Sequence

MEQDDPVEALTELRERRLGALELLQAAAGSGLAAYAVWALLLQPGFRRVPLRLQVPYVGASARQVEHVLS      1 - 70
LLRGRPGKTVDLGSGDGRIVLAAHRCGLRPAVGYELNPWLVALARLHAWRAGCAGSVCYRRKDLWKVSLR     71 - 140
DCRNVSVFLAPSVLPLLEDKLRTELPAGARVVSGRFPLPTWQPVTAVGEGLDRVWAYDVPEGGQAGEAAS    141 - 210
SRIPIQAAPGPSSAPIPGGLISQAS                                                 211 - 235
//

Text Mined References (6)

PMID Year Title
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.