Property Summary

NCBI Gene PubMed Count 11
Grant Count 1
Funding $74,955.75
PubMed Score 4.67
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.900 0.001

Synonym

Accession Q9BQD3 O76098
Symbols KXDL
BORCS4
MST096
MSTP096
C19orf50

Gene

 Grant Application (1)

Gene RIF (2)

PMID Text
22554196 KXD1 interacts with BLOS1.
18854154 Knockdown of KxDL motif containing 1 (KXD1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MDLPDSASRVFCGRILSMVNTDDVNAIILAQKNMLDRFEKTNEMLLNFNNLSSARLQQMSERFLHHTRTL      1 - 70
VEMKRDLDSIFRRIRTLKGKLARQHPEAFSHIPEASFLEEEDEDPIPPSTTTTIATSEQSTGSCDTSPDT     71 - 140
VSPSLSPGFEDLSHVQPGSPAINGRSQTDDEEMTGE                                      141 - 176
//

Text Mined References (14)

PMID Year Title
25898167 2015 BORC, a multisubunit complex that regulates lysosome positioning.
25416956 2014 A proteome-scale map of the human interactome network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22554196 2012 The BLOS1-interacting protein KXD1 is involved in the biogenesis of lysosome-related organelles.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21159114 2011 Yeast homologues of three BLOC-1 subunits highlight KxDL proteins as conserved interactors of BLOC-1.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...