Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.67
PubTator Score 0.75

Knowledge Summary


No data available


  Disease (3)

Disease Target Count P-value
diabetes mellitus 1728 4.2e-03
Disease Target Count Z-score Confidence
Brain cancer 30 0.0 0.9
Disease Target Count Z-score Confidence
Hermansky-Pudlak syndrome 42 5.015 2.5


  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.500 4.2e-03


Accession Q9BQD3 O76098
Symbols KXDL


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (2)

AA Sequence

VSPSLSPGFEDLSHVQPGSPAINGRSQTDDEEMTGE                                      141 - 176

Text Mined References (16)

PMID Year Title