Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 1.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 0.024

Synonym

Accession Q9BQD1
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MLSQKTKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTLEKRETGDEENSAKFPIGRRDFD      1 - 70
TLRCMLGRVYQRCWQV                                                           71 - 86
//

Text Mined References (4)

PMID Year Title
19068116 2008 Primate-specific spliced PMCHL RNAs are non-protein coding in human and macaque tissues.
11181993 2001 Birth of two chimeric genes in the Hominidae lineage.
11070051 2000 Structure and expression of the variant melanin-concentrating hormone genes: only PMCHL1 is transcribed in the developing human brain and encodes a putative protein.
8188237 1994 Assignment of the human pro-melanin-concentrating hormone gene (PMCH) to chromosome 12q23-q24 and two variant genes (PMCH1 and PMCHL2) to chromosome 5p14 and 5q12-q13.