Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 1.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.4e-02

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 2.4e-02

Synonym

Accession Q9BQD1
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MLSQKTKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTLEKRETGDEENSAKFPIGRRDFD      1 - 70
TLRCMLGRVYQRCWQV                                                           71 - 86
//

Text Mined References (4)

PMID Year Title