Property Summary

NCBI Gene PubMed Count 350
Grant Count 76
R01 Count 42
Funding $14,156,751.17
PubMed Score 550.72
PubTator Score 667.15

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BQB6 A6NIQ6 B2R4Z6 Q6UX90 Q7Z2R4
Symbols VKOR
MST134
MST576
VKCFD2
EDTP308

Gene

PANTHER Protein Class (1)

Gene RIF (410)

PMID Text
27434945 ESR1 and VKORC1 single nucleotide polymorphisms were used to determine the vitamin K dosage in patients with ulcer-related hemorrhage.
26939421 There was no difference in distribution of polymorphic genes ESR1 and VKORC1 in peptic ulcer hemorrhage patients of both sexes, with the exception of A/A VKORC1 genotype found in women.
26781925 presence of CYP2C9*3 or VKORC1*2 gene polymorphism were associated with decrease in acenocoumarol dose requirements
26757860 Patients with VKORC1-1639A allele were more likely to require lower doses of both drugs than patients with the G allele (Odds ratio [OR] for acenocoumarol 9.06, and OR for warfarin = 18.7).
26600534 Our meta-analysis provides strong evidence that two SNPs in the VKORC1 gene, rs2359612 and rs9923231, contribute to the risk of cardiovascular and cerebrovascular diseases.
26583785 This study explored the correlations of VKORC1-1639 G/A, 1173 C/T and 497 T/G genetic polymorphisms with warfarin maintenance dose requirement in patients undergoing cardiac valve
26513304 A protein homology model of human VKORC1 was constructed to elucidate the binding modes of vitamin K 2,3-epoxide, R-warfarin, & S-warfarin in wild-type & mutant VKORC1 enzymes. Structural analysis of each model in conjunction with automated in-silico docking, provided a mechanism that explains warfarin resistance associated with the Val66Met & other VKORC1 polymorphisms.
26505400 we identified differences in the frequency distribution in the Tibetan population located in the ALOX5 , VKORC1 and PTGS2 genes
26445138 VKORC1 1173C>T and VKORC1 -1639G>A gene polymorphisms are associated with stable warfarin maintenance dose and adverse events of warfarin therapy.
26422867 VKORC1 genotypic data-based dose prediction alone does not accurately predict warfarin dose requirements in some Malaysian patients.
More...

AA Sequence

MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVL      1 - 70
GQDSILNQSNSIFGCIFYTLQLLLGCLRTRWASVLMLLSSLVSLAGSVYLAWILFFVLYDFCIVCITTYA     71 - 140
INVSLMWLSFRKVQEPQGKAKRH                                                   141 - 163
//

Text Mined References (354)

PMID Year Title
27434945 2016 [HORMONALLY-GENETICALLY DEPENDENT THERAPY, USING VITAMIN K IN PATIENTS, SUFFERING THE ULCER HEMORRHAGE].
26939421 2015 [HORMONAL-GENETIC SCREENING IN PATIENTS, SUFFERING GASTRODUODENAL ULCER HEMORRHAGE].
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26781925 2015 High prevalence of VKORC1*3 (G9041A) genetic polymorphism in north Indians: A study on patients with cardiac disorders on acenocoumarol.
26757860 2015 [Effect of VKORC1 and CYP2C9 variants on dosage of oral anticoagulants in Chilean individuals].
26600534 2015 VKORC1 rs2359612 and rs9923231 polymorphisms correlate with high risks of cardiovascular and cerebrovascular diseases.
26583785 2015 Effects of VKORC1 Genetic Polymorphisms on Warfarin Maintenance Dose Requirement in a Chinese Han Population.
26513304 2016 Warfarin resistance associated with genetic polymorphism of VKORC1: linking clinical response to molecular mechanism using computational modeling.
26505400 2015 Genetic polymorphisms in very important pharmacogenomic (VIP) variants in the Tibetan population.
26445138 2015 VKORC1 gene polymorphisms and adverse events in Croatian patients on warfarin therapy.
More...