Property Summary

Ligand Count 5
NCBI Gene PubMed Count 366
PubMed Score 572.83
PubTator Score 667.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (14)

Gene RIF (426)

AA Sequence

MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVL      1 - 70
GQDSILNQSNSIFGCIFYTLQLLLGCLRTRWASVLMLLSSLVSLAGSVYLAWILFFVLYDFCIVCITTYA     71 - 140
INVSLMWLSFRKVQEPQGKAKRH                                                   141 - 163
//

Text Mined References (370)

PMID Year Title