Property Summary

NCBI Gene PubMed Count 191
Grant Count 178
R01 Count 98
Funding $17,196,458.62
PubMed Score 819.56
PubTator Score 369.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
non-small cell lung cancer 1.003 0.012
atypical teratoid/rhabdoid tumor 1.900 0.040
psoriasis 3.400 0.000

Synonym

Accession Q9BQB4 Q495N9
Symbols CDD
VBCH
DAND6
SOST1

Gene

PDB

3SOV   2K8P  

Gene RIF (180)

PMID Text
26576474 The aims of this study were to evaluate OCN and sclerostin levels in subjects who underwent coronary artery bypass graft (CABG) surgery compared with those in normal controls.
26545120 SOST and DKK1 have opposing effects on PC3 cell invasion and bone-derived Wnt signaling positively contributes to the invasive phenotypes of PC3
26505822 Serum sclerostin levels inversely associated with vascular calcification burden and progression in prevalent renal transplant recipients
26393301 SOST production is decreased via the androgen receptor activation. Serum SOST is elevated in hypogonadism patients compared to controls.
26283468 two affected siblings who carried a novel nonsense mutation of SOST in a consanguineous family from China, is reported.
26250343 The correlation of SOST polymorphisms with changes of BMD and bone biomarkers after treatment was analyzed.
26232882 highly sulfated glycosaminoglycans might control bone homeostasis via interference with sclerostin/LRP5/6 complex formation.
26204161 significantly lower sclerostin levels in newborns born by women with vitamin D deficiency compared with newborns of nondeficient mothers.
26119318 It is released from osteocytes and it regulated osteoblast activity through Wnt/beta-catenin pathway.
26112182 1,25D is a direct regulator of human SOST gene and sclerostin protein expression
More...

AA Sequence

MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPF      1 - 70
ETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYR     71 - 140
AQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELE    141 - 210
NAY                                                                       211 - 213
//

Text Mined References (192)

PMID Year Title
26576474 2016 Lower uncarboxylated osteocalcin and higher sclerostin levels are significantly associated with coronary artery disease.
26545120 2015 SOST Inhibits Prostate Cancer Invasion.
26505822 2015 Sclerostin Serum Levels and Vascular Calcification Progression in Prevalent Renal Transplant Recipients.
26393301 2015 Regulation of Sclerostin Production in Human Male Osteocytes by Androgens: Experimental and Clinical Evidence.
26283468 2016 Sclerosteosis caused by a novel nonsense mutation of SOST in a consanguineous family.
26250343 2015 SOST polymorphisms and response to alendronate treatment in postmenopausal Chinese women with osteoporosis.
26232882 2015 Structural and functional insights into sclerostin-glycosaminoglycan interactions in bone.
26204161 2015 Serum Sclerostin Levels in Newborns Born to Mothers With Vitamin D Deficiency.
26119318 2015 [Bone and Nutrition. Sclerostin and bone metabolism].
26112182 2015 1?,25-dihydroxyvitamin D3 stimulates human SOST gene expression and sclerostin secretion.
More...