Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.92
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
cutaneous lupus erythematosus 1.200 0.008
psoriasis 1.100 0.001
glioblastoma 1.500 0.008
osteosarcoma -1.525 0.001
astrocytoma 1.600 0.003
interstitial cystitis 1.300 0.000
adult high grade glioma 1.200 0.000
pilocytic astrocytoma 1.200 0.000
progressive supranuclear palsy -1.100 0.018
Breast cancer 1.200 0.000
gastric carcinoma 1.200 0.013
ovarian cancer 2.200 0.000

AA Sequence

MYLQVETRTSSRLHLKRAPGIRSWSLLVGILSIGLAAAYYSGDSLGWKLFYVTGCLFVAVQNLEDWEEAI      1 - 70
FDKSTGKVVLKTFSLYKKLLTLFRAGHDQVVVLLHDVRDVSVEEEKVRYFGKGYMVVLRLATGFSHPLTQ     71 - 140
SAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS                           141 - 187
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25279986 2014 Genome-wide association study identifies five susceptibility loci for follicular lymphoma outside the HLA region.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21503106 2011 [Study on the mechanism of C17orf62 induced cell death].
21269460 2011 Initial characterization of the human central proteome.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
More...