Property Summary

NCBI Gene PubMed Count 42
Grant Count 190
R01 Count 138
Funding $9,815,169.41
PubMed Score 20.03
PubTator Score 16.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
lung cancer 4,466
ovarian neoplasm 97

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.500 0.003

Synonym

Accession Q9BQA1 B3KMW6 B4DP38 Q3LID2 Q53FU2 Q6JZZ5 Q96GK4 Q9BWY3 MEP-50
Symbols p44
MEP50
MEP-50
HKMT1069
Nbla10071
p44/Mep50

Gene

PANTHER Protein Class (1)

PDB

4GQB   5FA5   4X60   4X61   4X63   5C9Z   5EMJ   5EMK   5EML   5EMM  

Gene RIF (15)

PMID Text
26763441 MEP50 genes reduces gene expression through histone arginine methylation in keratinocytes.
25713080 Data indicate that MEP50 WD repeat protein is essential for methylation of histones H4 and H2A by PRMT5 arginine methyltransferase.
25277535 MEP50 can transform cells independent of AR and ER.
23755100 These findings characterize PKG as a novel regulator of AR-mediated transcription by enhancing AR cofactor p44/WDR77's function.
23734213 Data indicate a transcription complex androgen receptor (AR)-p44-Smad1, and confirmed for physical interaction by co-immunoprecipitaion.
23145110 These studies suggest a novel mechanism by which proliferation and differentiation of prostate epithelial cells are controlled by WDR77's location in the cell.
23071334 structure of the surprising hetero-octameric complex reveals the close interaction between the seven-bladed beta-propeller MEP50 and the N-terminal domain of PRMT5, and delineates the structural elements of substrate recognition.
22022581 p44 plays a role in mediating the effects of hormones during ovarian tumorigenesis.
21789256 These results provide a basis for understanding subcellular transport of p44/WDR77 during prostate development and tumorigenesis.
19840198 expression and function of p44 in breast cancer; expression of p44 shows strong cytoplasmic expression in morphologically normal terminal ductal lobular units, while nuclear p44 is observed in both ductal carcinoma in situ and invasive carcinoma
More...

AA Sequence

MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNE      1 - 70
GFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQA     71 - 140
VSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSA    141 - 210
PGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSL    211 - 280
AVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVPTEPLPAPGPASVTE            281 - 342
//

Text Mined References (49)

PMID Year Title
26763441 2016 MEP50/PRMT5 Reduces Gene Expression by Histone Arginine Methylation and this Is Reversed by PKC?/p38? Signaling.
25713080 2015 Histone H2A and H4 N-terminal tails are positioned by the MEP50 WD repeat protein for efficient methylation by the PRMT5 arginine methyltransferase.
25662273 2015 The PRMT5 arginine methyltransferase: many roles in development, cancer and beyond.
25374906 2014 Androgen receptor coactivators that inhibit prostate cancer growth.
25284789 2014 5-Hydroxymethylcytosine plays a critical role in glioblastomagenesis by recruiting the CHTOP-methylosome complex.
25277535 2014 Methylosome protein 50 promotes androgen- and estrogen-independent tumorigenesis.
24944016 2014 P44/WDR77 restricts the sensitivity of proliferating cells to TGF? signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23892143 2013 Human respiratory syncytial virus N, P and M protein interactions in HEK-293T cells.
23755100 2014 cGMP-dependent protein kinase I? interacts with p44/WDR77 to regulate androgen receptor-driven gene expression.
More...