Property Summary

NCBI Gene PubMed Count 16
Grant Count 4
Funding $191,157
PubMed Score 14.12
PubTator Score 7.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Synonym

Accession Q9BQ95 E9PAN9 K7EMM0 Q96HQ7 Q9NYI1
Symbols SITPEC

Gene

Gene RIF (7)

PMID Text
25449573 Authors conclude that ECSIT appears to be a novel Hepatitis B virus X protein-interacting signal molecule and their interaction is mechanistically important in IL-1beta induction of NF-kappaB activation.
25371197 Data show that the ECSIT (evolutionarily conserved signaling intermediate in Toll pathways) complex, including MEKK7 (TAK1) and TNF receptor-associated factor 6 (TRAF6), plays a role in Toll-like receptor 4 -mediated signals to activate NF-kappa B.
25355951 Ubiquitination of ECSIT might have a role in the regulation of NF-kappaB activity in TLR4 signaling.
25228397 mediates virus-triggered type I IFN induction by bridging RIG-I and MDA5 to the VISA complex
22588174 TRIM59 interacts with ECSIT as an adaptor protein required for the TLR-mediated transduction pathway.
20877624 Observational study of gene-disease association. (HuGE Navigator)
17344420 Study shows a mitochondrial function for Ecsit in the assembly of mitochondrial complex I, an N-terminal targeting signal directs Ecsit to mitochondria, where it interacts with assembly chaperone NDUFAF1.

AA Sequence

MSWVQATLLARGLCRAWGGTCGAALTGTSISQVPRRLPRGLHCSAAAHSSEQSLVPSPPEPRQRPTKALV      1 - 70
PFEDLFGQAPGGERDKASFLQTVQKFAEHSVRKRGHIDFIYLALRKMREYGVERDLAVYNQLLNIFPKEV     71 - 140
FRPRNIIQRIFVHYPRQQECGIAVLEQMENHGVMPNKETEFLLIQIFGRKSYPMLKLVRLKLWFPRFMNV    141 - 210
NPFPVPRDLPQDPVELAMFGLRHMEPDLSARVTIYQVPLPKDSTGAADPPQPHIVGIQSPDQQAALARHN    211 - 280
PARPVFVEGPFSLWLRNKCVYYHILRADLLPPEEREVEETPEEWNLYYPMQLDLEYVRSGWDNYEFDINE    281 - 350
VEEGPVFAMCMAGAHDQATMAKWIQGLQETNPTLAQIPVVFRLAGSTRELQTSSAGLEEPPLPEDHQEED    351 - 420
DNLQRQQQGQS                                                               421 - 431
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25449573 2015 Hepatitis B virus X protein increases the IL-1?-induced NF-?B activation via interaction with evolutionarily conserved signaling intermediate in Toll pathways (ECSIT).
25371197 2014 TAK1-ECSIT-TRAF6 complex plays a key role in the TLR4 signal to activate NF-?B.
25355951 2015 Ubiquitination of ECSIT is crucial for the activation of p65/p50 NF-?Bs in Toll-like receptor 4 signaling.
25228397 2015 ECSIT bridges RIG-I-like receptors to VISA in signaling events of innate antiviral responses.
22982022 2012 Complexome profiling identifies TMEM126B as a component of the mitochondrial complex I assembly complex.
22588174 2012 TRIM59 interacts with ECSIT and negatively regulates NF-?B and IRF-3/7-mediated signal pathways.
21269460 2011 Initial characterization of the human central proteome.
21163940 2011 Interactome mapping suggests new mechanistic details underlying Alzheimer's disease.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
More...