Property Summary

NCBI Gene PubMed Count 16
PubMed Score 16.49
PubTator Score 7.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma -1.100 4.3e-04
intraductal papillary-mucinous neoplasm ... -1.100 2.3e-02
malignant mesothelioma 1.100 1.1e-05
subependymal giant cell astrocytoma -1.068 1.5e-02

Gene RIF (7)

AA Sequence

MSWVQATLLARGLCRAWGGTCGAALTGTSISQVPRRLPRGLHCSAAAHSSEQSLVPSPPEPRQRPTKALV      1 - 70
PFEDLFGQAPGGERDKASFLQTVQKFAEHSVRKRGHIDFIYLALRKMREYGVERDLAVYNQLLNIFPKEV     71 - 140
FRPRNIIQRIFVHYPRQQECGIAVLEQMENHGVMPNKETEFLLIQIFGRKSYPMLKLVRLKLWFPRFMNV    141 - 210
NPFPVPRDLPQDPVELAMFGLRHMEPDLSARVTIYQVPLPKDSTGAADPPQPHIVGIQSPDQQAALARHN    211 - 280
PARPVFVEGPFSLWLRNKCVYYHILRADLLPPEEREVEETPEEWNLYYPMQLDLEYVRSGWDNYEFDINE    281 - 350
VEEGPVFAMCMAGAHDQATMAKWIQGLQETNPTLAQIPVVFRLAGSTRELQTSSAGLEEPPLPEDHQEED    351 - 420
DNLQRQQQGQS                                                               421 - 431
//

Text Mined References (21)

PMID Year Title