Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.56
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy -1.246 2.6e-05
astrocytoma -1.300 8.1e-03
dermatomyositis -1.300 6.9e-03
malignant mesothelioma 1.800 6.9e-07
osteosarcoma 1.081 1.1e-02
Rheumatoid arthritis -1.300 6.9e-03
subependymal giant cell astrocytoma -1.699 4.8e-03

Synonym

Accession Q9BQ90 A8K2W9
Symbols PEAS
dJ20C7.3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (1)

AA Sequence

MLRWTVHLEGGPRRVNHAAVAVGHRVYSFGGYCSGEDYETLRQIDVHIFNAVSLRWTKLPPVKSAIRGQA      1 - 70
PVVPYMRYGHSTVLIDDTVLLWGGRNDTEGACNVLYAFDVNTHKWFTPRVSGTVPGARDGHSACVLGKIM     71 - 140
YIFGGYEQQADCFSNDIHKLDTSTMTWTLICTKGSPARWRDFHSATMLGSHMYVFGGRADRFGPFHSNNE    141 - 210
IYCNRIRVFDTRTEAWLDCPPTPVLPEGRRSHSAFGYNGELYIFGGYNARLNRHFHDLWKFNPVSFTWKK    211 - 280
IEPKGKGPCPRRRQCCCIVGDKIVLFGGTSPSPEEGLGDEFDLIDHSDLHILDFSPSLKTLCKLAVIQYN    281 - 350
LDQSCLPHDIRWELNAMTTNSNISRPIVSSHG                                          351 - 382
//

Text Mined References (13)

PMID Year Title