Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.56
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 6.94223698805531E-7
acute quadriplegic myopathy 1157 2.072646757641E-6
subependymal giant cell astrocytoma 2287 0.00475383364856263
Rheumatoid Arthritis 1171 0.00688370532161952
dermatomyositis 967 0.00691416773513132
astrocytoma 1493 0.0080895486109072
osteosarcoma 7933 0.010906348170031
Disease Target Count Z-score Confidence
Schizoaffective disorder 33 3.637 1.8

Expression

  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis -1.300 0.007
malignant mesothelioma 1.800 0.000
osteosarcoma 1.081 0.011
astrocytoma -1.300 0.008
acute quadriplegic myopathy -1.676 0.000
subependymal giant cell astrocytoma -1.699 0.005
dermatomyositis -1.300 0.007

Synonym

Accession Q9BQ90 A8K2W9
Symbols PEAS
dJ20C7.3

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid

Gene RIF (1)

PMID Text
12606021 cloned human and mouse Peas cDNAs (hPEAS/mPeas) and analyzed their tissue and stage-specific expressions; may be involved in meiotic recombination process

AA Sequence

MLRWTVHLEGGPRRVNHAAVAVGHRVYSFGGYCSGEDYETLRQIDVHIFNAVSLRWTKLPPVKSAIRGQA      1 - 70
PVVPYMRYGHSTVLIDDTVLLWGGRNDTEGACNVLYAFDVNTHKWFTPRVSGTVPGARDGHSACVLGKIM     71 - 140
YIFGGYEQQADCFSNDIHKLDTSTMTWTLICTKGSPARWRDFHSATMLGSHMYVFGGRADRFGPFHSNNE    141 - 210
IYCNRIRVFDTRTEAWLDCPPTPVLPEGRRSHSAFGYNGELYIFGGYNARLNRHFHDLWKFNPVSFTWKK    211 - 280
IEPKGKGPCPRRRQCCCIVGDKIVLFGGTSPSPEEGLGDEFDLIDHSDLHILDFSPSLKTLCKLAVIQYN    281 - 350
LDQSCLPHDIRWELNAMTTNSNISRPIVSSHG                                          351 - 382
//

Text Mined References (13)

PMID Year Title
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12755172 2003 Peas-Mea1-Ppp2r5d overlapping gene complex: a transposon mediated-gene formation in mammals.
12606021 2003 A novel testis-specific RAG2-like protein, Peas: its expression in pachytene spermatocyte cytoplasm and meiotic chromatin.
More...