Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.63
PubTator Score 1.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
medulloblastoma, large-cell 1.100 0.002
breast carcinoma 1.300 0.000
fibroadenoma 1.100 0.004
group 3 medulloblastoma 1.200 0.000
ductal carcinoma in situ 1.600 0.000
invasive ductal carcinoma 1.600 0.001

Gene RIF (1)

PMID Text
17499476 Protein with cell cycle-regulated expression and distinct conserved motifs, which localizes to centrosomes and spindle poles.

AA Sequence

MPVHTLSPGAPSAPALPCRLRTRVPGYLLRGPADGGARKPSAVERLEADKAKYVKSLHVANTRQEPVQPL      1 - 70
LSKQPLFSPETRRTVLTPSRRALPGPCRRPQLDLDILSSLIDLCDSPVSPAEASRTPGRAEGAGRPPPAT     71 - 140
PPRPPPSTSAVRRVDVRPLPASPARPCPSPGPAAASSPARPPGLQRSKSDLSERFSRAAADLERFFNFCG    141 - 210
LDPEEARGLGVAHLARASSDIVSLAGPSAGPGSSEGGCSRRSSVTVEERARERVPYGVSVVERNARVIKW    211 - 280
LYGLRQARESPAAEG                                                           281 - 295
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
17499476 2007 Characterization of the FAM110 gene family.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.