Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.76
PubTator Score 1.65

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
breast carcinoma 1.300 3.4e-04
ductal carcinoma in situ 1.600 3.9e-04
fibroadenoma 1.100 3.7e-03
group 3 medulloblastoma 1.200 3.4e-04
invasive ductal carcinoma 1.600 5.3e-04
medulloblastoma, large-cell 1.100 1.7e-03

Synonym

Accession Q9BQ89 D3DVW2 Q5R1M7
Symbols F10
C20orf55
bA371L19.3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MPVHTLSPGAPSAPALPCRLRTRVPGYLLRGPADGGARKPSAVERLEADKAKYVKSLHVANTRQEPVQPL      1 - 70
LSKQPLFSPETRRTVLTPSRRALPGPCRRPQLDLDILSSLIDLCDSPVSPAEASRTPGRAEGAGRPPPAT     71 - 140
PPRPPPSTSAVRRVDVRPLPASPARPCPSPGPAAASSPARPPGLQRSKSDLSERFSRAAADLERFFNFCG    141 - 210
LDPEEARGLGVAHLARASSDIVSLAGPSAGPGSSEGGCSRRSSVTVEERARERVPYGVSVVERNARVIKW    211 - 280
LYGLRQARESPAAEG                                                           281 - 295
//

Text Mined References (8)

PMID Year Title