Property Summary

NCBI Gene PubMed Count 9
PubMed Score 15.64
PubTator Score 17.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (6)

AA Sequence

MSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPSALISILQKGLQYVEAEISINKDG      1 - 70
TVFDSRPIESLSLIVAVIPDVVQMRQQAFGEKLTQQQASAAATEASAMAKAATMTPAAISQQNPPKNREA     71 - 140
TVNGEENGAHEINNHSKPMEIDGDVEIPPNKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNE    141 - 210
NSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNSDGTLLAMGSYDGFARIWTENGNLASTLGQHKGPIF    211 - 280
ALKWNKKGNYVLSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNMTFASCSTDMCIHVCRLGCDH    281 - 350
PVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDACVHDLQAHSKEIYTIKWSPTGPATSNPN    351 - 420
SSIMLASASFDSTVRLWDVEQGVCTHTLMKHQEPVYSVAFSPDGKYLASGSFDKYVHIWNTQSGSLVHSY    421 - 490
QGTGGIFEVCWNARGDKVGASASDGSVCVLDL                                          491 - 522
//

Text Mined References (10)

PMID Year Title