Property Summary

NCBI Gene PubMed Count 9
PubMed Score 14.14
PubTator Score 17.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession Q9BQ87 A1L4B3
Symbols TBL1

Gene

Gene RIF (6)

PMID Text
26070566 TBL1 is required to protect GPS2 from degradation, with methylation of GPS2 by arginine methyltransferase PRMT6 regulating the interaction with TBL1 and inhibiting proteasome-dependent degradation.
22280357 Our findings suggest that TBL1Y is involved in the genesis of non-syndromic coarctation of the aorta.
21189284 Taken together,these findings suggest that TBL1 controls NF-kB activation by recruiting NF-kB to its target gene promoter.
19605777 investigated 12 single-nucleotide polymorphisms in Y-linked neuroligin 4, transducin b-like 1, and eukaryotic translation initiation factor 1a genes, results suggest a Y chromosome effect in autism
19605777 Observational study of gene-disease association. (HuGE Navigator)
18511697 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPSALISILQKGLQYVEAEISINKDG      1 - 70
TVFDSRPIESLSLIVAVIPDVVQMRQQAFGEKLTQQQASAAATEASAMAKAATMTPAAISQQNPPKNREA     71 - 140
TVNGEENGAHEINNHSKPMEIDGDVEIPPNKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNE    141 - 210
NSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNSDGTLLAMGSYDGFARIWTENGNLASTLGQHKGPIF    211 - 280
ALKWNKKGNYVLSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNMTFASCSTDMCIHVCRLGCDH    281 - 350
PVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDACVHDLQAHSKEIYTIKWSPTGPATSNPN    351 - 420
SSIMLASASFDSTVRLWDVEQGVCTHTLMKHQEPVYSVAFSPDGKYLASGSFDKYVHIWNTQSGSLVHSY    421 - 490
QGTGGIFEVCWNARGDKVGASASDGSVCVLDL                                          491 - 522
//

Text Mined References (10)

PMID Year Title
26070566 2015 Exchange Factor TBL1 and Arginine Methyltransferase PRMT6 Cooperate in Protecting G Protein Pathway Suppressor 2 (GPS2) from Proteasomal Degradation.
22280357 2012 Functional null mutations in the gonosomal homologue gene TBL1Y are associated with non-syndromic coarctation of the aorta.
21189284 2011 Transducin ?-like protein 1 recruits nuclear factor ?B to the target gene promoter for transcriptional activation.
19605777 2009 Association of Y chromosome haplotypes with autism.
18511697 2008 Genetic variants of Y chromosome are associated with a protective lipid profile in black men.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14660691 2004 Sex differences in structure and expression of the sex chromosome genes CHD1Z and CHD1W in zebra finches.
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.