Property Summary

NCBI Gene PubMed Count 8
PubMed Score 11.58

Knowledge Summary

Patent

No data available

TINX Plot

Expression

AA Sequence

MGPAGVAARPGRFFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGRGPWEMVLVVH      1 - 70
GFPSSVAALRFEWAWQHPHASRRLAHVGPRLRGETAFAFHLRVLAHMLRAPPWARLPLTLRWVRPDLRQD     71 - 140
LCLPPPPHVPLAFGPPPPQAPAPRRRAGPFDDAEPEPDQGDPGACCSLCAQTIQDEEGPLCCPHPGCLLR    141 - 210
AHVICLAEEFLQEEPGQLLPLEGQCPCCEKSLLWGDLIWLCQMDTEKEVEDSELEEAHWTDLLET         211 - 275
//

Text Mined References (10)

PMID Year Title