Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.91
PubTator Score 5.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
hereditary spastic paraplegia 1.244 8.7e-05
malignant mesothelioma 2.100 5.4e-05
ovarian cancer -1.500 5.2e-04
primary Sjogren syndrome -1.100 4.4e-02
Rheumatoid arthritis 1.100 2.0e-02

Synonym

Accession Q9BQ70 Q2MK75 Q9UPV3 TCF-25
Symbols Hulp1
NULP1
FKSG26
PRO2620
hKIAA1049

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MSRRALRRLRGEQRGQEPLGPGALHFDLRDDDDAEEEGPKRELGVRRPGGAGKEGVRVNNRFELINIDDL      1 - 70
EDDPVVNGERSGCALTDAVAPGNKGRGQRGNTESKTDGDDTETVPSEQSHASGKLRKKKKKQKNKKSSTG     71 - 140
EASENGLEDIDRILERIEDSTGLNRPGPAPLSSRKHVLYVEHRHLNPDTELKRYFGARAILGEQRPRQRQ    141 - 210
RVYPKCTWLTTPKSTWPRYSKPGLSMRLLESKKGLSFFAFEHSEEYQQAQHKFLVAVESMEPNNIVVLLQ    211 - 280
TSPYHVDSLLQLSDACRFQEDQEMARDLVERALYSMECAFHPLFSLTSGACRLDYRRPENRSFYLALYKQ    281 - 350
MSFLEKRGCPRTALEYCKLILSLEPDEDPLCMLLLIDHLALRARNYEYLIRLFQEWEAHRNLSQLPNFAF    351 - 420
SVPLAYFLLSQQTDLPECEQSSARQKASLLIQQALTMFPGVLLPLLESCSVRPDASVSSHRFFGPNAEIS    421 - 490
QPPALSQLVNLYLGRSHFLWKEPATMSWLEENVHEVLQAVDAGDPAVEACENRRKVLYQRAPRNIHRHVI    491 - 560
LSEIKEAVAALPPDVTTQSVMGFDPLPPSDTIYSYVRPERLSPISHGNTIALFFRSLLPNYTMEGERPEE    561 - 630
GVAGGLNRNQGLNRLMLAVRDMMANFHLNDLEAPHEDDAEGEGEWD                            631 - 676
//

Text Mined References (20)

PMID Year Title