Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.35
PubTator Score 5.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.020
malignant mesothelioma 2.100 0.000
hereditary spastic paraplegia 1.244 0.000
primary Sjogren syndrome -1.100 0.044
ovarian cancer 2.700 0.000

Gene RIF (5)

PMID Text
25184702 Hearing ability was strongly associated with DNA methylation levels in the promoter regions of several genes, including TCF25, FGFR1, and POLE.
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
18068114 These results indicate that Nulp1 plays a role in cell death control and may influence tumor growth.
16574069 hnulp1 may act as a novel transcriptional repressor in serum response factor signaling pathways.

AA Sequence

MSRRALRRLRGEQRGQEPLGPGALHFDLRDDDDAEEEGPKRELGVRRPGGAGKEGVRVNNRFELINIDDL      1 - 70
EDDPVVNGERSGCALTDAVAPGNKGRGQRGNTESKTDGDDTETVPSEQSHASGKLRKKKKKQKNKKSSTG     71 - 140
EASENGLEDIDRILERIEDSTGLNRPGPAPLSSRKHVLYVEHRHLNPDTELKRYFGARAILGEQRPRQRQ    141 - 210
RVYPKCTWLTTPKSTWPRYSKPGLSMRLLESKKGLSFFAFEHSEEYQQAQHKFLVAVESMEPNNIVVLLQ    211 - 280
TSPYHVDSLLQLSDACRFQEDQEMARDLVERALYSMECAFHPLFSLTSGACRLDYRRPENRSFYLALYKQ    281 - 350
MSFLEKRGCPRTALEYCKLILSLEPDEDPLCMLLLIDHLALRARNYEYLIRLFQEWEAHRNLSQLPNFAF    351 - 420
SVPLAYFLLSQQTDLPECEQSSARQKASLLIQQALTMFPGVLLPLLESCSVRPDASVSSHRFFGPNAEIS    421 - 490
QPPALSQLVNLYLGRSHFLWKEPATMSWLEENVHEVLQAVDAGDPAVEACENRRKVLYQRAPRNIHRHVI    491 - 560
LSEIKEAVAALPPDVTTQSVMGFDPLPPSDTIYSYVRPERLSPISHGNTIALFFRSLLPNYTMEGERPEE    561 - 630
GVAGGLNRNQGLNRLMLAVRDMMANFHLNDLEAPHEDDAEGEGEWD                            631 - 676
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25184702 2014 Epigenome-wide DNA methylation in hearing ability: new mechanisms for an old problem.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19060904 2009 An empirical framework for binary interactome mapping.
More...