Property Summary

NCBI Gene PubMed Count 23
PubMed Score 20.50
PubTator Score 23.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
nephrosclerosis -1.303 0.006
malignant mesothelioma 1.100 0.000
psoriasis -1.400 0.000
group 3 medulloblastoma 1.100 0.004
ulcerative colitis -1.300 0.000

Gene RIF (15)

PMID Text
26261536 The results indicate that abnormal LRP16 expression is noted in neuroendocrine lung tumors and the expression can give insight into the pathogenesis of the disease.
25735744 LRP16, through its constitutive interactions with PARP1 and IKKgamma, functions to facilitate the lesion-specific recruitment of PARP1 and IKKgamma and, ultimately, the concomitant recruitment of PIASy to IKKgamma in response to DNA damage.
21483817 Findings not only indicate that LRP16 is a crucial regulator for NF-kappaB activation inside the nucleus, but also suggest that LRP16 may be an important contributor to the aberrant activation of NF-kappaB in tumors.
20355243 LRP16 expression is related to the degree of differentiation, invasiveness, metastasis and prognosis of colorectal carcinoma.
20035625 K18 attenuates estrogen receptor alpha-mediated signaling by sequestering LRP16 in cytoplasm.
19958623 LRP16 may play an important role in leukemia progression by promoting cell proliferation, regulating cell cycle, and antagonizing radiation-induced DNA damage.
19840441 LRP16 gene overexpression shows a promotive effect on proliferation of K562 cells.
19824120 LRP16 may have a role in invasion, metastasis and prognosis of gastric cancer
19698216 lrp16 is a leukemic oncogene and closely relates to genesis and progression of leukemia.
19403568 The unliganded ERalpha upregulated LRP16 expression and enhanced LRP16 promoter activity in SKOV3 cells; however, this induction was blocked by estrogen stimulation.
More...

AA Sequence

MSLQSRLSGRLAQLRAAGQLLVPPRPRPGHLAGATRTRSSTCGPPAFLGVFGRRARTSAGVGAWGAAAVG      1 - 70
RTAGVRTWAPLAMAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMAKGVAVKVE     71 - 140
EPRYKKDKQLNEKISLLRSDITKLEVDAIVNAANSSLLGGGGVDGCIHRAAGPLLTDECRTLQSCKTGKA    141 - 210
KITGGYRLPAKYVIHTVGPIAYGEPSASQAAELRSCYLSSLDLLLEHRLRSVAFPCISTGVFGYPCEAAA    211 - 280
EIVLATLREWLEQHKDKVDRLIICVFLEKDEDIYRSRLPHYFPVA                             281 - 325
//

Text Mined References (26)

PMID Year Title
26261536 2015 Aberrant LRP16 protein expression in primary neuroendocrine lung tumors.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25735744 2015 An LRP16-containing preassembly complex contributes to NF-?B activation induced by DNA double-strand breaks.
23474712 2013 A family of macrodomain proteins reverses cellular mono-ADP-ribosylation.
21483817 2011 LRP16 integrates into NF-?B transcriptional complex and is required for its functional activation.
21269460 2011 Initial characterization of the human central proteome.
21257746 2011 Identification of macrodomain proteins as novel O-acetyl-ADP-ribose deacetylases.
20355243 2010 Clinicopathological significance and prognostic value of LRP16 expression in colorectal carcinoma.
20035625 2009 Keratin 18 attenuates estrogen receptor alpha-mediated signaling by sequestering LRP16 in cytoplasm.
19958623 2009 [LRP16 gene function based on bioinformatic analysis].
More...