Property Summary

NCBI Gene PubMed Count 23
PubMed Score 23.14
PubTator Score 23.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 7.0e-08
ulcerative colitis 1819 7.4e-07
malignant mesothelioma 3232 1.4e-05
group 3 medulloblastoma 4104 3.9e-03
nephrosclerosis 333 5.6e-03
Disease Target Count Z-score Confidence
Leukemia 104 3.252 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.100 3.9e-03
malignant mesothelioma 1.100 1.4e-05
nephrosclerosis -1.303 5.6e-03
psoriasis -1.400 7.0e-08
ulcerative colitis -1.300 7.4e-07

Gene RIF (15)

AA Sequence

MSLQSRLSGRLAQLRAAGQLLVPPRPRPGHLAGATRTRSSTCGPPAFLGVFGRRARTSAGVGAWGAAAVG      1 - 70
RTAGVRTWAPLAMAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMAKGVAVKVE     71 - 140
EPRYKKDKQLNEKISLLRSDITKLEVDAIVNAANSSLLGGGGVDGCIHRAAGPLLTDECRTLQSCKTGKA    141 - 210
KITGGYRLPAKYVIHTVGPIAYGEPSASQAAELRSCYLSSLDLLLEHRLRSVAFPCISTGVFGYPCEAAA    211 - 280
EIVLATLREWLEQHKDKVDRLIICVFLEKDEDIYRSRLPHYFPVA                             281 - 325
//

Text Mined References (27)

PMID Year Title