Property Summary

NCBI Gene PubMed Count 25
PubMed Score 34.81
PubTator Score 36.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

Gene RIF (15)

AA Sequence

MSAAPLVGYSSSGSEDESEDGMRTRPGDGSHRRGQSPLPRQRFPVPDSVLNMFPGTEEGPEDDSTKHGGR      1 - 70
VRTFPHERGNWATHVYVPYEAKEEFLDLLDVLLPHAQTYVPRLVRMKVFHLSLSQSVVLRHHWILPFVQA     71 - 140
LKARMTSFHRFFFTANQVKIYTNQEKTRTFIGLEVTSGHAQFLDLVSEVDRVMEEFNLTTFYQDPSFHLS    141 - 210
LAWCVGDARLQLEGQCLQELQAIVDGFEDAEVLLRVHTEQVRCKSGNKFFSMPLK                   211 - 265
//

Text Mined References (25)

PMID Year Title