Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.00

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.4e-05


  Differential Expression (1)

Disease log2 FC p
ovarian cancer 2.000 1.4e-05


Accession Q9BQ61
Symbols TERCIR


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

EVLTSKGDAWAKYMAEVKKYKAHQCGDDDKTRPLVK                                      141 - 176

Text Mined References (9)

PMID Year Title