Property Summary

NCBI Gene PubMed Count 56
PubMed Score 59.96
PubTator Score 64.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count P-value
ovarian cancer 8520 1.4e-05
astrocytoma 1146 6.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Mitochondrial complex I deficiency 46 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
Combined oxidative phosphorylation deficiency 14 3.897 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
astrocytoma 1.100 6.9e-03
ovarian cancer 1.300 1.4e-05

 MGI Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (54)

AA Sequence

MWALCSLLRSAAGRTMSQGRTISQAPARRERPRKDPLRHLRTREKRGPSGCSGGPNTVYLQVVAAGSRDS      1 - 70
GAALYVFSEFNRYLFNCGEGVQRLMQEHKLKVARLDNIFLTRMHWSNVGGLSGMILTLKETGLPKCVLSG     71 - 140
PPQLEKYLEAIKIFSGPLKGIELAVRPHSAPEYEDETMTVYQIPIHSEQRRGKHQPWQSPERPLSRLSPE    141 - 210
RSSDSESNENEPHLPHGVSQRRGVRDSSLVVAFICKLHLKRGNFLVLKAKEMGLPVGTAAIAPIIAAVKD    211 - 280
GKSITHEGREILAEELCTPPDPGAAFVVVECPDESFIQPICENATFQRYQGKADAPVALVVHMAPASVLV    281 - 350
DSRYQQWMERFGPDTQHLVLNENCASVHNLRSHKIQTQLNLIHPDIFPLLTSFRCKKEGPTLSVPMVQGE    351 - 420
CLLKYQLRPRREWQRDAIITCNPEEFIVEALQLPNFQQSVQEYRRSAQDGPAPAEKRSQYPEIIFLGTGS    421 - 490
AIPMKIRNVSATLVNISPDTSLLLDCGEGTFGQLCRHYGDQVDRVLGTLAAVFVSHLHADHHTGLPSILL    491 - 560
QRERALASLGKPLHPLLVVAPNQLKAWLQQYHNQCQEVLHHISMIPAKCLQEGAEISSPAVERLISSLLR    561 - 630
TCDLEEFQTCLVRHCKHAFGCALVHTSGWKVVYSGDTMPCEALVRMGKDATLLIHEATLEDGLEEEAVEK    631 - 700
THSTTSQAISVGMRMNAEFIMLNHFSQRYAKVPLFSPNFSEKVGVAFDHMKVCFGDFPTMPKLIPPLKAL    701 - 770
FAGDIEEMEERREKRELRQVRAALLSRELAGGLEDGEPQQKRAHTEEPQAKKVRAQ                  771 - 826
//

Text Mined References (63)

PMID Year Title