Property Summary

NCBI Gene PubMed Count 65
Grant Count 197
R01 Count 113
Funding $21,098,240.45
PubMed Score 211.00
PubTator Score 123.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
lung cancer -1.400 0.002
interstitial cystitis 1.100 0.000
lung adenocarcinoma -1.100 0.000
lung carcinoma -2.400 0.000

Synonym

Accession Q9BQ51 Q14CN8 Q5T7Z6 Q6JXL8 Q6JXL9 PD-1 ligand 2
Symbols B7DC
Btdc
PDL2
CD273
PD-L2
PDCD1L2
bA574F11.2

Gene

Gene RIF (57)

PMID Text
26913631 We observed cogain or coamplification of CD274 and PDCD1LG2 in 32 of 48 cervical and 10 of 23 vulvar squamous cell carcinomas
26752545 PD-L1 and PD-L2 are useful new markers for identifying select histiocyte and dendritic cell disorders and reveal novel patient populations as rational candidates for immunotherapy
26599163 knocking down in dendritic cells results in activation of inflammatory T cells
26541326 Report PD-L2 expression in breast neoplasms.
26464193 High PD-L2 expression is associated with Renal Cell Carcinoma.
26432559 PDL2 could promote the ability of human placenta-derived mesenchymal stromal cells to augment the secretion of IL-10.
26424759 PD-L2 expression was neither associated with VEGF-TKI responsiveness nor patients' outcome
26329973 Data indicate that pulmonary pleomorphic carcinoma (PC) very frequently express CD274 antigen (PD-L1) and CD273 antigen (PD-L2).
26317899 Genomic amplification of 9p24.1 targeting JAK2, PD-L1, and PD-L2 is enriched in high-risk triple negative breast cancer.
26133691 We suggest that decreased expression of programmed death-ligand 1, 2 on psoriatic epidermis can contribute to its chronic unregulated inflammatory characteristics.
More...

AA Sequence

MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHR      1 - 70
ERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVE     71 - 140
LTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQ    141 - 210
SQMEPRTHPTWLLHIFIPFCIIAFIFIATVIALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI           211 - 273
//

Text Mined References (65)

PMID Year Title
26913631 2016 Genetic Basis for PD-L1 Expression in Squamous Cell Carcinomas of the Cervix and Vulva.
26752545 2016 Expression of Programmed Cell Death 1 Ligands (PD-L1 and PD-L2) in Histiocytic and Dendritic Cell Disorders.
26599163 2015 PDL-1/PDL-2 blockade in mice dendritic cells by RNAi techniques to induce antitumor immunity.
26541326 2016 Prognostic significance of PD-L1 and PD-L2 in breast cancer.
26464193 2016 Clinicopathologic Analysis of PD-L1 and PD-L2 Expression in Renal Cell Carcinoma: Association with Oncogenic Proteins Status.
26432559 2015 Interferon-? and tumor necrosis factor-? promote the ability of human placenta-derived mesenchymal stromal cells to express programmed death ligand-2 and induce the differentiation of CD4(+)interleukin-10(+) and CD8(+)interleukin-10(+)Treg subsets.
26424759 2015 The Association Between PD-L1 Expression and the Clinical Outcomes to Vascular Endothelial Growth Factor-Targeted Therapy in Patients With Metastatic Clear Cell Renal Cell Carcinoma.
26329973 2015 Programmed death-1 ligand 1 and 2 are highly expressed in pleomorphic carcinomas of the lung: Comparison of sarcomatous and carcinomatous areas.
26317899 2015 Genomic amplification of 9p24.1 targeting JAK2, PD-L1, and PD-L2 is enriched in high-risk triple negative breast cancer.
26133691 2015 Programmed death-ligand 1, 2 expressions are decreased in the psoriatic epidermis.
More...