Property Summary

NCBI Gene PubMed Count 77
PubMed Score 253.90
PubTator Score 123.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
interstitial cystitis 1.100 1.2e-04
lung adenocarcinoma -1.100 1.1e-06
lung cancer -1.400 1.9e-03
lung carcinoma -2.400 9.8e-21
malignant mesothelioma -1.400 5.4e-05

Protein-protein Interaction (3)

Gene RIF (69)

AA Sequence

MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHR      1 - 70
ERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVE     71 - 140
LTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQ    141 - 210
SQMEPRTHPTWLLHIFIPFCIIAFIFIATVIALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI           211 - 273
//

Text Mined References (77)

PMID Year Title