Property Summary

NCBI Gene PubMed Count 29
PubMed Score 1.25
PubTator Score 33.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
diabetes mellitus 1,663
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 3.400 0.000
diabetes mellitus 1.100 0.002

Gene RIF (11)

PMID Text
26090614 Altogether, data provide new insights in the molecular mechanisms of TREX2 activity and establish cell autonomous and non-cell autonomous functions of TREX2 in the UVB-induced skin response.
24896180 human TREX-2 complex prevents genome instability, as determined by the accumulation of gamma-H2AX and 53BP1 foci and single-cell electrophoresis in cells depleted of the TREX-2 subunits PCID2, GANP and DSS1
23591820 TREX-2 is an NPC-associated complex in mammalian cells.
21546543 Trex2 does not enable DSB repair and prompt a new model that posits Trex2 suppresses the formation of broken chromosomes.
19321497 a model for DNA binding and 3' hydrolysis for the TREX2 dimer.
19094998 Trex2 deletion caused high levels of Robertsonian translocations (RbTs) showing Trex2 is important for chromosomal maintenance.
18534978 analysis of cooperative DNA binding and communication across the dimer interface in the TREX2 3' --> 5'-exonuclease
18092167 Observational study of gene-disease association. (HuGE Navigator)
17426129 Results suggest that TREX2 plays an important function during DNA metabolism and cellular proliferation.
15661738 analysis of human TREX2 3' -> 5'-exonuclease structure and description of the mechanism for efficient nonprocessive DNA catalysis
More...

AA Sequence

MGRAGSPLPRSSWPRMDDCGSRSRCSPTLCSSLRTCYPRGNITMSEAPRAETFVFLDLEATGLPSVEPEI      1 - 70
AELSLFAVHRSSLENPEHDESGALVLPRVLDKLTLCMCPERPFTAKASEITGLSSEGLARCRKAGFDGAV     71 - 140
VRTLQAFLSRQAGPICLVAHNGFDYDFPLLCAELRRLGARLPRDTVCLDTLPALRGLDRAHSHGTRARGR    141 - 210
QGYSLGSLFHRYFRAEPSAAHSAEGDVHTLLLIFLHRAAELLAWADEQARGWAHIEPMYLPPDDPSLEA     211 - 279
//

Text Mined References (29)

PMID Year Title
26090614 2015 Multifaceted role of TREX2 in the skin defense against UV-induced skin carcinogenesis.
24896180 2014 BRCA2 prevents R-loop accumulation and associates with TREX-2 mRNA export factor PCID2.
23591820 2013 The human TREX-2 complex is stably associated with the nuclear pore basket.
22027841 2011 Correct end use during end joining of multiple chromosomal double strand breaks is influenced by repair protein RAD50, DNA-dependent protein kinase DNA-PKcs, and transcription context.
21546543 2011 Trex2 enables spontaneous sister chromatid exchanges without facilitating DNA double-strand break repair.
21079684 2010 ATM limits incorrect end utilization during non-homologous end joining of multiple chromosome breaks.
19321497 2009 DNA binding induces active site conformational change in the human TREX2 3'-exonuclease.
19094998 2009 TREX2 exonuclease defective cells exhibit double-strand breaks and chromosomal fragments but not Robertsonian translocations.
18534978 2008 Cooperative DNA binding and communication across the dimer interface in the TREX2 3' --> 5'-exonuclease.
18092167 2008 TREX1 polymorphisms associated with autoantibodies in patients with systemic lupus erythematosus.
More...