Property Summary

NCBI Gene PubMed Count 29
PubMed Score 1.25
PubTator Score 33.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.7e-12
diabetes mellitus 1728 1.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.100 1.6e-03
psoriasis 3.400 1.7e-12

Gene RIF (11)

AA Sequence

MGRAGSPLPRSSWPRMDDCGSRSRCSPTLCSSLRTCYPRGNITMSEAPRAETFVFLDLEATGLPSVEPEI      1 - 70
AELSLFAVHRSSLENPEHDESGALVLPRVLDKLTLCMCPERPFTAKASEITGLSSEGLARCRKAGFDGAV     71 - 140
VRTLQAFLSRQAGPICLVAHNGFDYDFPLLCAELRRLGARLPRDTVCLDTLPALRGLDRAHSHGTRARGR    141 - 210
QGYSLGSLFHRYFRAEPSAAHSAEGDVHTLLLIFLHRAAELLAWADEQARGWAHIEPMYLPPDDPSLEA     211 - 279
//

Text Mined References (29)

PMID Year Title