Property Summary

Ligand Count 3
NCBI Gene PubMed Count 16
PubMed Score 11.59
PubTator Score 12.81

Knowledge Summary

Patent (1,576)

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy -1.029 4.4e-03
autosomal dominant Emery-Dreifuss muscul... -1.138 3.3e-03
cystic fibrosis 1.115 2.2e-04
Duchenne muscular dystrophy -1.213 1.1e-06
ependymoma -1.200 1.2e-08
group 3 medulloblastoma -1.200 8.6e-03
lung cancer -2.800 1.3e-04
malignant mesothelioma 1.900 3.3e-05
medulloblastoma, large-cell -1.500 1.8e-03
ovarian cancer 1.100 5.7e-03
ulcerative colitis 1.600 3.1e-02

Gene RIF (8)

AA Sequence

MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDYSVADKEYYFD      1 - 70
RNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSNRYQERKEENHEKDWDQKSHDV     71 - 140
STDSSFEESSLFEKELEKFDTLRFGQLRKKIWIRMENPAYCLSAKLIAISSLSVVLASIVAMCVHSMSEF    141 - 210
QNEDGEVDDPVLEGVEIACIAWFTGELAVRLAAAPCQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESE    211 - 280
DIENMGKVVQILRLMRIFRILKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDDH    281 - 350
TSSLTSIPICWWWATISMTTVGYGDTHPVTLAGKLIASTCIICGILVVALPITIIFNKFSKYYQKQKDID    351 - 420
VDQCSEDAPEKCHELPYFNIRDIYAQRMHTFITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLENCTA    421 - 490
K//

Text Mined References (18)

PMID Year Title