| Tclin | Potassium voltage-gated channel subfamily S member 3 |
Potassium channel subunit that does not form functional channels by itself. Can form functional heterotetrameric channels with KCNB1; modulates the delayed rectifier voltage-gated potassium channel activation and deactivation rates of KCNB1 (PubMed:10484328). Heterotetrameric channel activity formed with KCNB1 show increased current amplitude with the threshold for action potential activation shifted towards more negative values in hypoxic-treated pulmonary artery smooth muscle cells (By similarity).
Voltage-gated potassium channels form the largest and most diversified class of ion channels and are present in both excitable and nonexcitable cells. Their main functions are associated with the regulation of the resting membrane potential and the control of the shape and frequency of action potentials. The alpha subunits are of 2 types: those that are functional by themselves and those that are electrically silent but capable of modulating the activity of specific functional alpha subunits. The protein encoded by this gene is not functional by itself but can form heteromultimers with member 1 and with member 2 (and possibly other members) of the Shab-related subfamily of potassium voltage-gated channel proteins. This gene belongs to the S subfamily of the potassium channel family. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Sep 2013]
Voltage-gated potassium channels form the largest and most diversified class of ion channels and are present in both excitable and nonexcitable cells. Their main functions are associated with the regulation of the resting membrane potential and the control of the shape and frequency of action potentials. The alpha subunits are of 2 types: those that are functional by themselves and those that are electrically silent but capable of modulating the activity of specific functional alpha subunits. The protein encoded by this gene is not functional by itself but can form heteromultimers with member 1 and with member 2 (and possibly other members) of the Shab-related subfamily of potassium voltage-gated channel proteins. This gene belongs to the S subfamily of the potassium channel family. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Sep 2013]
Comments
| Disease | Target Count |
|---|---|
| Schizophrenia | 1160 |
| Disease | Target Count |
|---|---|
| Eaton-Lambert syndrome | 40 |
| Multiple Sclerosis | 540 |
| Disease | Target Count | P-value |
|---|---|---|
| ependymoma | 4679 | 1.2e-08 |
| Duchenne muscular dystrophy | 601 | 1.1e-06 |
| malignant mesothelioma | 3232 | 3.3e-05 |
| lung cancer | 4740 | 1.3e-04 |
| cystic fibrosis | 1696 | 2.2e-04 |
| medulloblastoma, large-cell | 6241 | 1.8e-03 |
| autosomal dominant Emery-Dreifuss muscular dystrophy | 510 | 3.3e-03 |
| acute quadriplegic myopathy | 1158 | 4.4e-03 |
| ovarian cancer | 8520 | 5.7e-03 |
| group 3 medulloblastoma | 4104 | 8.6e-03 |
| ulcerative colitis | 1819 | 3.1e-02 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Amyotrophic lateral sclerosis | 451 | 0.0 | 0.7 |
| Bipolar Disorder | 666 | 0.0 | 1.2 |
| Chronic obstructive pulmonary disease | 184 | 0.0 | 1.0 |
| Motor neuron disease | 49 | 0.0 | 2.1 |
| Disease | log2 FC | p |
|---|---|---|
| acute quadriplegic myopathy | -1.029 | 4.4e-03 |
| autosomal dominant Emery-Dreifuss muscul... | -1.138 | 3.3e-03 |
| cystic fibrosis | 1.115 | 2.2e-04 |
| Duchenne muscular dystrophy | -1.213 | 1.1e-06 |
| ependymoma | -1.200 | 1.2e-08 |
| group 3 medulloblastoma | -1.200 | 8.6e-03 |
| lung cancer | -2.800 | 1.3e-04 |
| malignant mesothelioma | 1.900 | 3.3e-05 |
| medulloblastoma, large-cell | -1.500 | 1.8e-03 |
| ovarian cancer | 1.100 | 5.7e-03 |
| ulcerative colitis | 1.600 | 3.1e-02 |
MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDYSVADKEYYFD 1 - 70 RNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSNRYQERKEENHEKDWDQKSHDV 71 - 140 STDSSFEESSLFEKELEKFDTLRFGQLRKKIWIRMENPAYCLSAKLIAISSLSVVLASIVAMCVHSMSEF 141 - 210 QNEDGEVDDPVLEGVEIACIAWFTGELAVRLAAAPCQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESE 211 - 280 DIENMGKVVQILRLMRIFRILKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDDH 281 - 350 TSSLTSIPICWWWATISMTTVGYGDTHPVTLAGKLIASTCIICGILVVALPITIIFNKFSKYYQKQKDID 351 - 420 VDQCSEDAPEKCHELPYFNIRDIYAQRMHTFITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLENCTA 421 - 490 K//
