Tclin | Potassium voltage-gated channel subfamily S member 3 |
Potassium channel subunit that does not form functional channels by itself. Can form functional heterotetrameric channels with KCNB1; modulates the delayed rectifier voltage-gated potassium channel activation and deactivation rates of KCNB1 (PubMed:10484328). Heterotetrameric channel activity formed with KCNB1 show increased current amplitude with the threshold for action potential activation shifted towards more negative values in hypoxic-treated pulmonary artery smooth muscle cells (By similarity).
Voltage-gated potassium channels form the largest and most diversified class of ion channels and are present in both excitable and nonexcitable cells. Their main functions are associated with the regulation of the resting membrane potential and the control of the shape and frequency of action potentials. The alpha subunits are of 2 types: those that are functional by themselves and those that are electrically silent but capable of modulating the activity of specific functional alpha subunits. The protein encoded by this gene is not functional by itself but can form heteromultimers with member 1 and with member 2 (and possibly other members) of the Shab-related subfamily of potassium voltage-gated channel proteins. This gene belongs to the S subfamily of the potassium channel family. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Sep 2013]
Voltage-gated potassium channels form the largest and most diversified class of ion channels and are present in both excitable and nonexcitable cells. Their main functions are associated with the regulation of the resting membrane potential and the control of the shape and frequency of action potentials. The alpha subunits are of 2 types: those that are functional by themselves and those that are electrically silent but capable of modulating the activity of specific functional alpha subunits. The protein encoded by this gene is not functional by itself but can form heteromultimers with member 1 and with member 2 (and possibly other members) of the Shab-related subfamily of potassium voltage-gated channel proteins. This gene belongs to the S subfamily of the potassium channel family. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Sep 2013]
Comments
Disease | Target Count |
---|---|
Eaton-Lambert syndrome | 40 |
Multiple Sclerosis | 498 |
Disease | Target Count | P-value |
---|---|---|
posterior fossa group B ependymoma | 1530 | 3.64316501305036E-8 |
Duchenne muscular dystrophy | 602 | 1.11306655158681E-6 |
malignant mesothelioma | 3163 | 3.26566800855049E-5 |
lung cancer | 4473 | 4.3243403724782E-5 |
cystic fibrosis | 1670 | 2.16619447269597E-4 |
group 4 medulloblastoma | 1875 | 3.99646076856505E-4 |
medulloblastoma, large-cell | 6234 | 0.00178365595955928 |
autosomal dominant Emery-Dreifuss muscular dystrophy | 499 | 0.00327701429789716 |
acute quadriplegic myopathy | 1157 | 0.00441284624680888 |
ovarian cancer | 8492 | 0.00568045739505635 |
ulcerative colitis | 2087 | 0.031238901260538 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Bipolar Disorder | 266 | 0.0 | 1.0 |
Chronic obstructive pulmonary disease | 147 | 0.0 | 1.0 |
Motor neuron disease | 39 | 0.0 | 2.0 |
Disease | log2 FC | p |
---|---|---|
malignant mesothelioma | 1.900 | 0.000 |
posterior fossa group B ependymoma | -1.400 | 0.000 |
cystic fibrosis | 1.115 | 0.000 |
medulloblastoma, large-cell | -1.500 | 0.002 |
Duchenne muscular dystrophy | -1.213 | 0.000 |
autosomal dominant Emery-Dreifuss muscul... | -1.138 | 0.003 |
acute quadriplegic myopathy | -1.029 | 0.004 |
lung cancer | -3.800 | 0.000 |
group 4 medulloblastoma | -1.300 | 0.000 |
ulcerative colitis | 1.600 | 0.031 |
ovarian cancer | 1.100 | 0.006 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Chicken | OMA Inparanoid |
Anole lizard | OMA Inparanoid |
Xenopus | OMA Inparanoid |
PMID | Text |
---|---|
24170294 | By in situ hybridization, KCNS3 mRNA levels were 23% lower in schizophrenia subjects than in controls. At the cellular level, both KCNS3 mRNA-expressing neuron density and KCNS3 mRNA level per neuron were significantly lower. |
22943705 | study concluded that potassium voltage-gated channel K(V)9.3 is localised to human placental vascular tissues and syncytiotrophoblast |
22422395 | stromatoxin-1 -sensitive KV2-containing channels are expressed in detrusor smooth muscle (DSM); they control DSM excitability, intracellular Ca2+ levels, and myogenic and nerve-evoked contractions |
20876197 | There is evidence of heteromultimeric Kv2.1/Kv9.3 channel expression in control of middle cerebral arterial diameter. |
18676988 | Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator) |
15827117 | formation of heteromeric Kv2.1/Kv9.3 channels of fixed stoichiometry consisting of three Kv2.1 subunits and one Kv9.3 subunit |
15714333 | Observational study of gene-disease association. (HuGE Navigator) |
15714333 | Our findings suggest that SNPs located at the 3' downstream region of KCNS3 have a significant role in the etiology of AHR. |
MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDYSVADKEYYFD 1 - 70 RNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSNRYQERKEENHEKDWDQKSHDV 71 - 140 STDSSFEESSLFEKELEKFDTLRFGQLRKKIWIRMENPAYCLSAKLIAISSLSVVLASIVAMCVHSMSEF 141 - 210 QNEDGEVDDPVLEGVEIACIAWFTGELAVRLAAAPCQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESE 211 - 280 DIENMGKVVQILRLMRIFRILKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDDH 281 - 350 TSSLTSIPICWWWATISMTTVGYGDTHPVTLAGKLIASTCIICGILVVALPITIIFNKFSKYYQKQKDID 351 - 420 VDQCSEDAPEKCHELPYFNIRDIYAQRMHTFITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLENCTA 421 - 490 K//
PMID | Year | Title |
---|---|---|
24170294 | 2014 | Lower gene expression for KCNS3 potassium channel subunit in parvalbumin-containing neurons in the prefrontal cortex in schizophrenia. |
22943705 | 2012 | Expression of an electrically silent voltage-gated potassium channel in the human placenta. |
22422395 | 2012 | Expression and function of K(V)2-containing channels in human urinary bladder smooth muscle. |
20876197 | 2010 | Stromatoxin-sensitive, heteromultimeric Kv2.1/Kv9.3 channels contribute to myogenic control of cerebral arterial diameter. |
18676988 | 2008 | A high-density association screen of 155 ion transport genes for involvement with common migraine. |
18029348 | 2008 | Toward a confocal subcellular atlas of the human proteome. |
16382104 | 2005 | International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels. |
16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. |
15827117 | 2005 | Fluorescence measurements reveal stoichiometry of K+ channels formed by modulatory and delayed rectifier alpha-subunits. |
15815621 | 2005 | Generation and annotation of the DNA sequences of human chromosomes 2 and 4. |
More... |