Property Summary

NCBI Gene PubMed Count 16
PubMed Score 11.59
PubTator Score 12.81

Knowledge Summary

Patent (1,576)

Expression

  Differential Expression (11)

Gene RIF (8)

PMID Text
24170294 By in situ hybridization, KCNS3 mRNA levels were 23% lower in schizophrenia subjects than in controls. At the cellular level, both KCNS3 mRNA-expressing neuron density and KCNS3 mRNA level per neuron were significantly lower.
22943705 study concluded that potassium voltage-gated channel K(V)9.3 is localised to human placental vascular tissues and syncytiotrophoblast
22422395 stromatoxin-1 -sensitive KV2-containing channels are expressed in detrusor smooth muscle (DSM); they control DSM excitability, intracellular Ca2+ levels, and myogenic and nerve-evoked contractions
20876197 There is evidence of heteromultimeric Kv2.1/Kv9.3 channel expression in control of middle cerebral arterial diameter.
18676988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15827117 formation of heteromeric Kv2.1/Kv9.3 channels of fixed stoichiometry consisting of three Kv2.1 subunits and one Kv9.3 subunit
15714333 Observational study of gene-disease association. (HuGE Navigator)
15714333 Our findings suggest that SNPs located at the 3' downstream region of KCNS3 have a significant role in the etiology of AHR.

AA Sequence

MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDYSVADKEYYFD      1 - 70
RNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSNRYQERKEENHEKDWDQKSHDV     71 - 140
STDSSFEESSLFEKELEKFDTLRFGQLRKKIWIRMENPAYCLSAKLIAISSLSVVLASIVAMCVHSMSEF    141 - 210
QNEDGEVDDPVLEGVEIACIAWFTGELAVRLAAAPCQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESE    211 - 280
DIENMGKVVQILRLMRIFRILKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDDH    281 - 350
TSSLTSIPICWWWATISMTTVGYGDTHPVTLAGKLIASTCIICGILVVALPITIIFNKFSKYYQKQKDID    351 - 420
VDQCSEDAPEKCHELPYFNIRDIYAQRMHTFITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLENCTA    421 - 490
K//

Text Mined References (18)

PMID Year Title
24170294 2014 Lower gene expression for KCNS3 potassium channel subunit in parvalbumin-containing neurons in the prefrontal cortex in schizophrenia.
22943705 2012 Expression of an electrically silent voltage-gated potassium channel in the human placenta.
22422395 2012 Expression and function of K(V)2-containing channels in human urinary bladder smooth muscle.
20876197 2010 Stromatoxin-sensitive, heteromultimeric Kv2.1/Kv9.3 channels contribute to myogenic control of cerebral arterial diameter.
18676988 2008 A high-density association screen of 155 ion transport genes for involvement with common migraine.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16382104 2005 International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15827117 2005 Fluorescence measurements reveal stoichiometry of K+ channels formed by modulatory and delayed rectifier alpha-subunits.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...