Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.07
PubTator Score 4.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Synonym

Accession Q9BQ24 A8K3A4 Q86T05 Q96LT1 ZF21
Symbols ZF21
HCVP7TP1

Gene

PDB

2RRF  

Gene RIF (5)

PMID Text
23382803 this study demonstrates that ZF21 is a key player regulating multiple aspects of cancer cell migration and invasion.
21768110 the C-terminal region is important for the ability of ZF21 to induce disassembly of FAs and cell migration
20890123 ZF21 is a new regulator of focal adhesion disassembly and a potential member of the spreading initiation center. We identified 45 proteins including FA-related proteins and multiple RNA binding proteins
20601096 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSSEVSARRDAKKLVRSPSGLRMVPEHRAFGSPFGLEEPQWVPDKECRRCMQCDAKFDFLTRKHHCRRCG      1 - 70
KCFCDRCCSQKVPLRRMCFVDPVRQCAECALVSLKEAEFYDKQLKVLLSGATFLVTFGNSEKPETMTCRL     71 - 140
SNNQRYLFLDGDSHYEIEIVHISTVQILTEGFPPGGGNARATGMFLQYTVPGTEGVTQLKLTVVEDVTVG    141 - 210
RRQAVAWLVAMHKAAKLLYESRDQ                                                  211 - 234
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23382803 2013 The phosphoinositide-binding protein ZF21 regulates ECM degradation by invadopodia.
21768110 2011 ZF21 protein, a regulator of the disassembly of focal adhesions and cancer metastasis, contains a novel noncanonical pleckstrin homology domain.
20890123 ZF21 is a new regulator of focal adhesion disassembly and a potential member of the spreading initiation center.
20601096 2010 Single-nucleotide polymorphisms in DNA-repair genes and cutaneous melanoma.
20439989 2010 ZF21 protein regulates cell adhesion and motility.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...